ID MH139106; SV 1; linear; genomic DNA; STD; INV; 432 BP. XX AC MH139106; XX DT 12-JUN-2018 (Rel. 137, Created) DT 13-NOV-2018 (Rel. 138, Last updated, Version 2) XX DE Choeras sp. Extraction278 wingless (Wnt1) gene, partial cds. XX KW . XX OS Choeras sp. Extraction278 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Hymenoptera; Apocrita; Parasitoida; Ichneumonoidea; OC Braconidae; Microgastrinae; Choeras; unclassified Choeras. XX RN [1] RC Publication Status: Available-Online prior to print RP 1-432 RX PUBMED; 29791787. RA Fagan-Jeffries E.P., Cooper S.J., Bertozzi T., Bradford T.M., Austin A.D.; RT "DNA barcoding of microgastrine parasitoid wasps (Hymenoptera: Braconidae) RT using high-throughput methods more than doubles the number of species known RT for Australia"; RL Mol Ecol Resour 0:0(2018). XX RN [2] RP 1-432 RA Fagan-Jeffries E.P., Cooper S.J.B., Bertozzi T., Bradford T.M., RA Austin A.D.; RT ; RL Submitted (29-MAR-2018) to the INSDC. RL Ecology and Evolutionary Biology, The University of Adelaide, School of RL Biological Sciences, The University of Adelaide, Adelaide, South Australia RL 5005, Australia XX DR MD5; fe34839ce892d1bb2b4ef07c890e796e. XX FH Key Location/Qualifiers FH FT source 1..432 FT /organism="Choeras sp. Extraction278" FT /mol_type="genomic DNA" FT /country="Australia:Tasmania, Tarkine SSS2" FT /lat_lon="41.66 S 145.08 E" FT /specimen_voucher="Extraction278" FT /collected_by="Simon Grove" FT /collection_date="01-Feb-2015" FT /db_xref="taxon:2211988" FT gene <1..>432 FT /gene="Wnt1" FT mRNA <1..>432 FT /gene="Wnt1" FT /product="wingless" FT CDS <1..>432 FT /codon_start=1 FT /gene="Wnt1" FT /product="wingless" FT /db_xref="GOA:A0A2U9DPT5" FT /db_xref="InterPro:IPR005817" FT /db_xref="UniProtKB/TrEMBL:A0A2U9DPT5" FT /protein_id="AWP39561.1" FT /translation="SCTVKTCWMRLPLFKIVGDNLKDRFDGASRVMISNSDRIRGSGNA FT IISNSASNFVHGSRQGLGRRQRYSFQLKPYNPEHKPPGLKDLVYLEPSPAFCDKNPKLG FT ILGTQGRQCNDTSIGVDGCDLMCCGRGYRTQEVIVVERCA" XX SQ Sequence 432 BP; 130 A; 73 C; 101 G; 128 T; 0 other; tcatgtacag taaaaacatg ttggatgcgt cttccattat tcaaaatagt tggagacaat 60 ttaaaggatc gctttgatgg tgcatctcga gtcatgatca gtaattcaga tcggattcgc 120 ggttccggca atgctattat tagtaattct gccagtaatt ttgtccatgg ttctcgtcaa 180 ggtcttggcc gccgacagcg ttatagtttt caattgaaac cttataatcc agagcataaa 240 ccaccaggat taaaagattt ggtctactta gaaccatcgc cagcattttg tgataaaaat 300 cctaaacttg ggatattggg cactcaaggt aggcaatgca acgacacaag tattggagta 360 gatggatgtg atttaatgtg ctgtggaaga ggatatagaa cccaggaagt aattgttgta 420 gagagatgtg cg 432 //