ID MH128325; SV 1; linear; genomic DNA; STD; INV; 277 BP. XX AC MH128325; XX DT 12-MAY-2018 (Rel. 136, Created) DT 12-MAY-2018 (Rel. 136, Last updated, Version 1) XX DE Stenothoe irinae cytochrome c oxidase subunit I gene, partial cds; DE mitochondrial. XX KW . XX OS Stenothoe irinae OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Multicrustacea; OC Malacostraca; Eumalacostraca; Peracarida; Amphipoda; Amphilochidea; OC Amphilochida; Amphilochidira; Amphilochoidea; Stenothoidae; Stenothoe. OG Mitochondrion XX RN [1] RC Publication Status: Online-Only RP 1-277 RX DOI; .11646/zootaxa.4410.1.3. RX PUBMED; 29690156. RA Marin I., Sinelnikov S.; RT "Two new species of amphipod genus Stenothoe Dana, 1852 (Stenothoidae) RT associated with fouling assemblages from Nhatrang Bay, Vietnam"; RL Zootaxa 4410(1):57-76(2018). XX RN [2] RP 1-277 RA Marin I.N., Sinelnikov S.Y.; RT ; RL Submitted (26-MAR-2018) to the INSDC. RL Laboratory of Ecology of Aquatic Invertebrates, Papanin Institute for RL Biology of Inland Waters Russian Academy of Sciences, without street, RL Borok, Yaroslavl Region 152742, Russian Federation XX DR MD5; 1f0780c8d423311f45a0f2c993f3f144. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..277 FT /organism="Stenothoe irinae" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /country="Viet Nam" FT /lat_lon="12.2 N 109.29 E" FT /collected_by="I. Marin, S. Sinelnikov" FT /collection_date="Mar-2014" FT /sex="female" FT /db_xref="taxon:2182374" FT CDS <1..>277 FT /codon_start=1 FT /transl_table=5 FT /product="cytochrome c oxidase subunit I" FT /EC_number="1.9.3.1" FT /db_xref="GOA:A0A2S1PVI3" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A2S1PVI3" FT /protein_id="AWH63012.1" FT /translation="KDIGTLYFILGAWAGCVGTAMSMIIRWELSTPGSLISNDHLYNVM FT VTSHAFIMIFFMVMPIMVGGFGNWLVPLMLSSPDMAFPRMNNMSFWL" XX SQ Sequence 277 BP; 83 A; 52 C; 49 G; 93 T; 0 other; aaagatattg ggacacttta cttcatcctg ggtgcatgag ccgggtgtgt aggtaccgct 60 ataagaataa ttatccgttg agaattaaga acaccaggtt ctcttatttc taacgaccat 120 ttatataacg tcatagtaac tagccacgcc tttattataa tttttttcat agtaatacct 180 atcatagtcg gaggatttgg taactgactc gtccctctaa tactgagtag accagatata 240 gctttccctc gtatgaataa tataagattt tgattac 277 //