ID MF168950; SV 1; linear; genomic DNA; STD; INV; 129 BP. XX AC MF168950; XX DT 17-JAN-2019 (Rel. 139, Created) DT 17-JAN-2019 (Rel. 139, Last updated, Version 1) XX DE Cinachyra sp. 1 MC-2017 isolate B cytochrome oxidase subunit I (COI) gene, DE partial cds; mitochondrial. XX KW . XX OS Cinachyra sp. 1 MC-2017 OC Eukaryota; Metazoa; Porifera; Demospongiae; Heteroscleromorpha; OC Tetractinellida; Spirophorina; Tetillidae; Cinachyra; OC unclassified Cinachyra. OG Mitochondrion XX RN [1] RP 1-129 RA Carella M., Uriz Lespe M.J.; RT "Description of two new genera (Antarctotetilla, Levantiniella) and a new RT species of Tetillidae"; RL Unpublished. XX RN [2] RP 1-129 RA Carella M., Uriz Lespe M.J.; RT ; RL Submitted (30-MAY-2017) to the INSDC. RL Marine Ecology, CEAB-CSIC, C/ Acces a la cala St. Francesc, 14, Blanes, RL Girona 17300, Spain XX DR MD5; 8dddfd49f5933d06a0d2f1fb880f32c7. XX FH Key Location/Qualifiers FH FT source 1..129 FT /organism="Cinachyra sp. 1 MC-2017" FT /organelle="mitochondrion" FT /isolate="B" FT /mol_type="genomic DNA" FT /country="Antarctica" FT /lat_lon="65.33 S 62.27 E" FT /collected_by="Lendenfeld" FT /collection_date="1907" FT /identified_by="Lendenfeld" FT /note="holotype of Tethya crassispicula" FT /db_xref="taxon:2005546" FT gene <1..>129 FT /gene="COI" FT CDS <1..>129 FT /codon_start=1 FT /transl_table=4 FT /gene="COI" FT /product="cytochrome oxidase subunit I" FT /db_xref="GOA:A0A3S6IZM6" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A3S6IZM6" FT /protein_id="ASM56398.1" FT /translation="TLYLLFGVFSGMIGTGFSLLIRLELSAPGLMLGDDHLYNVMVT" XX SQ Sequence 129 BP; 31 A; 20 C; 28 G; 50 T; 0 other; accttatact tattatttgg tgttttttcg ggtatgatag gaactggatt tagcttgctt 60 attagattag aactatccgc tcccggatta atgttgggtg acgaccattt atacaatgtt 120 atggtcacg 129 //