ID MF168949; SV 1; linear; genomic DNA; STD; INV; 124 BP. XX AC MF168949; XX DT 17-JAN-2019 (Rel. 139, Created) DT 17-JAN-2019 (Rel. 139, Last updated, Version 1) XX DE Antarctotetilla coactifera isolate A cytochrome oxidase subunit I (COI) DE gene, partial cds; mitochondrial. XX KW . XX OS Antarctotetilla coactifera OC Eukaryota; Metazoa; Porifera; Demospongiae; Heteroscleromorpha; OC Tetractinellida; Spirophorina; Tetillidae; Antarctotetilla. OG Mitochondrion XX RN [1] RP 1-124 RA Carella M., Uriz Lespe M.J.; RT "Description of two new genera (Antarctotetilla, Levantiniella) and a new RT species of Tetillidae"; RL Unpublished. XX RN [2] RP 1-124 RA Carella M., Uriz Lespe M.J.; RT ; RL Submitted (30-MAY-2017) to the INSDC. RL Marine Ecology, CEAB-CSIC, C/ Acces a la cala St. Francesc, 14, Blanes, RL Girona 17300, Spain XX DR MD5; 57e4b28f9bda93124b8322f6e98bf665. XX FH Key Location/Qualifiers FH FT source 1..124 FT /organism="Antarctotetilla coactifera" FT /organelle="mitochondrion" FT /isolate="A" FT /mol_type="genomic DNA" FT /country="Antarctica" FT /lat_lon="65.33 S 62.27 E" FT /collected_by="Lendenfeld" FT /collection_date="1907" FT /identified_by="Lendenfeld" FT /note="syntype of Tethya coactifera" FT /db_xref="taxon:2005540" FT gene <1..>124 FT /gene="COI" FT CDS <1..>124 FT /codon_start=2 FT /transl_table=4 FT /gene="COI" FT /product="cytochrome oxidase subunit I" FT /db_xref="GOA:A0A3S6IVF3" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A3S6IVF3" FT /protein_id="ASM56397.1" FT /translation="YLLFGVFSGMIGTGFSLLIRLELSAPGLMLGDDHLYNVMVT" XX SQ Sequence 124 BP; 30 A; 18 C; 28 G; 48 T; 0 other; atacttatta tttggtgttt tttcgggtat gataggaact ggatttagct tgcttattag 60 attagaacta tccgctcccg gattaatgtt gggtgacgac catttataca atgttatggt 120 cacg 124 //