ID   M21569; SV 1; linear; genomic DNA; STD; HUM; 882 BP.
XX
AC   M21569;
XX
DT   22-APR-1989 (Rel. 19, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 7)
XX
DE   Homo sapiens transferrin (TF) gene, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-882
RX   DOI; 10.1016/0378-1119(86)90277-5.
RX   PUBMED; 3106157.
RA   Adrian G.S., Korinek B.W., Bowman B.H., Yang F.;
RT   "The human transferrin gene: 5' region contains conserved sequences which
RT   match the control elements regulated by heavy metals, glucocorticoids and
RT   acute phase reaction";
RL   Gene 49(2):167-175(1986).
XX
DR   MD5; 6899644e35e6eca353afc048e655abb3.
DR   Ensembl-Gn; ENSG00000091513; homo_sapiens.
DR   Ensembl-Tr; ENST00000402696; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..882
FT                   /organism="Homo sapiens"
FT                   /chromosome="3"
FT                   /map="3q21"
FT                   /mol_type="genomic DNA"
FT                   /clone="J85TF1"
FT                   /db_xref="taxon:9606"
FT   intron          <1..317
FT                   /gene="TF"
FT                   /number=1
FT                   /note="G00-120-432"
FT   mRNA            join(M15673.1:<1130..1172,318..>490)
FT                   /gene="TF"
FT                   /product="transferrin"
FT   CDS             join(M15673.1:1130..1172,318..>490)
FT                   /codon_start=1
FT                   /gene="TF"
FT                   /product="transferrin"
FT                   /number=1
FT                   /db_xref="GOA:P02787"
FT                   /db_xref="HGNC:HGNC:11740"
FT                   /db_xref="InterPro:IPR001156"
FT                   /db_xref="InterPro:IPR016357"
FT                   /db_xref="InterPro:IPR018195"
FT                   /db_xref="InterPro:IPR030685"
FT                   /db_xref="PDB:1A8E"
FT                   /db_xref="PDB:1A8F"
FT                   /db_xref="PDB:1B3E"
FT                   /db_xref="PDB:1BP5"
FT                   /db_xref="PDB:1BTJ"
FT                   /db_xref="PDB:1D3K"
FT                   /db_xref="PDB:1D4N"
FT                   /db_xref="PDB:1DTG"
FT                   /db_xref="PDB:1FQE"
FT                   /db_xref="PDB:1FQF"
FT                   /db_xref="PDB:1JQF"
FT                   /db_xref="PDB:1N7W"
FT                   /db_xref="PDB:1N7X"
FT                   /db_xref="PDB:1N84"
FT                   /db_xref="PDB:1OQG"
FT                   /db_xref="PDB:1OQH"
FT                   /db_xref="PDB:1RYO"
FT                   /db_xref="PDB:1SUV"
FT                   /db_xref="PDB:2HAU"
FT                   /db_xref="PDB:2HAV"
FT                   /db_xref="PDB:2O7U"
FT                   /db_xref="PDB:2O84"
FT                   /db_xref="PDB:3FGS"
FT                   /db_xref="PDB:3QYT"
FT                   /db_xref="PDB:3S9L"
FT                   /db_xref="PDB:3S9M"
FT                   /db_xref="PDB:3S9N"
FT                   /db_xref="PDB:3SKP"
FT                   /db_xref="PDB:3V83"
FT                   /db_xref="PDB:3V89"
FT                   /db_xref="PDB:3V8X"
FT                   /db_xref="PDB:3VE1"
FT                   /db_xref="PDB:4H0W"
FT                   /db_xref="PDB:4X1B"
FT                   /db_xref="PDB:4X1D"
FT                   /db_xref="PDB:5DYH"
FT                   /db_xref="UniProtKB/Swiss-Prot:P02787"
FT                   /protein_id="AAA61143.2"
FT                   /translation="MRLAVGALLVCAVLGLCLAVPDKTVRWCAVSEHEATKCQSFRDHM
FT                   KSVIPSDGPSVACVKKASYLDCIRAIA"
FT   exon            318..490
FT                   /gene="TF"
FT                   /number=2
FT   intron          491..>882
FT                   /gene="TF"
FT                   /number=2
FT                   /note="G00-120-432"
XX
SQ   Sequence 882 BP; 216 A; 196 C; 261 G; 208 T; 1 other;
     aggggccagg acagtgatgg gaggagacaa ggcggataca gaggagcaga ttgtcatctc        60
     cagctgggag gtgatgccat gcctgcaccc tctggccagc agagggtggt cagtaggaaa       120
     ctgggaggcc attagggcaa ccttctattg gctcagactc agaatgcagt agaacttgtg       180
     ccctgtagtg ttcatggaca ggagtgagag gaggacagga ctgaggggat gtggctgtca       240
     aggcctttct aggggcgatg ctgtctctcc ctcagcatag ggagtgggcc cttccacctc       300
     tggcctctct cccccagggc tgtgtctggc tgtccctgat aaaactgtga gatggtgtgc       360
     agtgtcggag catgaggcca ctaagtgcca gagtttccgc gaccatatga aaagcgtcat       420
     tccatccgat ggtcccagtg ttgcttgtgt gaagaaagcc tcctaccttg attgcatcag       480
     ggccattgcg gtaagtcgct gctgcctaaa agagagtgga agaaagccat actttctctg       540
     tttccagtca ctttggaaca attctttact cacaggtagg aggctgatat atggggcagt       600
     caaccttgac ttactaaaat cacttcaaaa gtggaaatgg ggaggttttc tttaangggt       660
     ctggaaagca aaagtcaaaa agcacattaa cttttgcttt ccagacacag tagacgcaag       720
     ggtgactgtt ttgagaccct aggttctctg aacttggcga aaatataaga atgcctgcta       780
     tcaggctggg cgcggtggct catgctgaaa tcctagcact ttgggaggct gaggcaggtg       840
     gatcacctga ggtcaggagt tcgagaccag cctggccaac at                          882
//