ID LC152968; SV 1; linear; genomic DNA; STD; INV; 650 BP. XX AC LC152968; XX DT 02-DEC-2016 (Rel. 131, Created) DT 16-JUL-2018 (Rel. 137, Last updated, Version 2) XX DE Rowedota motoshimaensis mitochondrial COX1 gene for cytochrome c oxidase DE subunit 1, partial cds. XX KW . XX OS Rowedota motoshimaensis OC Eukaryota; Metazoa; Echinodermata; Eleutherozoa; Echinozoa; Holothuroidea; OC Apodacea; Apodida; Chiridotidae; Rowedota. OG Mitochondrion XX RN [1] RP 1-650 RA Tanaka H., Yamana Y.; RT ; RL Submitted (15-MAY-2016) to the INSDC. RL Contact:Hayato Tanaka Hiroshima University, Takehara Marine Science RL Station; 5-8-1 Minatomachi, Takehara, Hiroshima 725-0024, Japan URL RL :http://fishlab.hiroshima-u.ac.jp/ XX RN [2] RC DOI:10.12782/sd.22_53 RA Yamana Y., Tanaka H., Nakachi S.; RT "Three New Shallow Species of Taeniogyrus and Rowedota (Echinodermata: RT Holothuroidea: Apodida: Chiridotidae: Taeniogyrinae) from Southern Japan"; RL Species Divers. 22:53-68(2017). XX DR MD5; 6855a674b2cefaae26d73e00926ff93a. XX FH Key Location/Qualifiers FH FT source 1..650 FT /organism="Rowedota motoshimaensis" FT /organelle="mitochondrion" FT /isolate="NR2" FT /mol_type="genomic DNA" FT /country="Japan" FT /lat_lon="33.73 N 135.35 E" FT /collected_by="Yusuke Yamana" FT /collection_date="2015-07-31" FT /PCR_primers="fwd_name: LCO1490, fwd_seq: FT ggtcaacaaatcataaagatattgg, rev_name: HCO2198, rev_seq: FT taaacttcagggtgaccaaaaaatca" FT /db_xref="taxon:1850431" FT CDS <1..>650 FT /codon_start=2 FT /transl_table=9 FT /gene="COX1" FT /product="cytochrome c oxidase subunit 1" FT /db_xref="GOA:A0A1L7MRP8" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A1L7MRP8" FT /protein_id="BAW15915.1" FT /translation="TLYLLFGVWAGLTGAALSVIIRMELSQAGSLLGDDQIYNVVVTAH FT AFIMIFFMVMPVMIGGFGNWLIPLMIGAPDMAFPRMNNMSFWLVPPSFFLLVASAIVES FT GVGTGWTVYPPLSSNIAHAGASVDLGIFSLHLAGASSILASINFITTVYNMRCYGISWD FT RLPLFVWSLFITSFLLLLSLPVLAGAITMLLTDRNINTSFFDPTGGGDPLLFQ" XX SQ Sequence 650 BP; 109 A; 90 C; 161 G; 290 T; 0 other; gactttgtat cttttatttg gtgtttgggc tggtcttact ggtgctgcgt tgagggtaat 60 tatacggatg gagttgaggc aggcgggctc tttattggga gatgatcaaa tctataatgt 120 tgttgtgact gctcatgctt ttataatgat tttttttatg gttatgcctg ttatgattgg 180 tgggtttggg aattggttaa ttcctttgat gataggtgct cctgatatgg cttttcctcg 240 tatgaaaaaa atgaggtttt ggttagttcc tccttctttt tttcttttgg tggcgtctgc 300 tattgttgag agtggggttg ggacgggttg gactgtgtat cctcctctgt ctagaaaaat 360 agctcatgct ggtgcttctg tggatttggg aattttttct ttacatttgg ctggggcttc 420 ttctattttg gcttcgataa attttataac tactgtttat aatatgcgtt gttatggtat 480 taggtgggat cgtcttcctc tttttgtttg gtctcttttt attacttctt ttttgttgtt 540 gttgtctttg cctgttttag ctggtgctat aactatgctt ttaactgatc ggaatattaa 600 tacttctttt tttgatccta ctggtggggg tgatcctttg ctatttcagc 650 //