ID KY962774; SV 1; linear; genomic DNA; STD; VRT; 607 BP. XX AC KY962774; XX DT 20-DEC-2017 (Rel. 135, Created) DT 29-JUN-2018 (Rel. 137, Last updated, Version 5) XX DE Pristimantis bounides voucher NMP6V75097 recombination activating protein 1 DE (RAG1) gene, partial cds. XX KW . XX OS Pristimantis bounides (hill dweller rubber frog) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; OC Batrachia; Anura; Neobatrachia; Hyloidea; Strabomantidae; Pristimantis. XX RN [1] RC Publication Status: Online-Only RP 1-607 RX PUBMED; 29187793. RA Lehr E., von May R., Moravec J., Cusi J.C.; RT "A new species of Phrynopus (Amphibia, Anura, Craugastoridae) from upper RT montane forests and high Andean grasslands of the Pui Pui Protected Forest RT in central Peru"; RL J. Anim. Genet. Zookeys(713):131-157(2017). XX RN [2] RP 1-607 RA von May R., Lehr E.; RT ; RL Submitted (17-APR-2017) to the INSDC. RL Ecology and Evolutionary Biology, University of Michigan, 2051 Ruthven RL Museums Building, 1109 Geddes Ave., Ann Arbor, MI 48109, USA XX DR MD5; 5ff91b59f9ea1e0bc97d59bc269141dd. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..607 FT /organism="Pristimantis bounides" FT /mol_type="genomic DNA" FT /country="Peru:Junin, Quebrada Tasta, ''Runda'', distrubed FT area with Ichu, mosses, and bushes next to a forest patch, FT found in center of sedge, rain" FT /lat_lon="11.45 S 74.89 W" FT /specimen_voucher="NMP6V75097" FT /collected_by="E. Lehr & R. von May" FT /collection_date="19-May-2012" FT /db_xref="taxon:2058353" FT /altitude="3463m" FT /type_material="paratype of Pristimantis bounides" FT gene <1..>607 FT /gene="RAG1" FT mRNA <1..>607 FT /gene="RAG1" FT /product="recombination activating protein 1" FT CDS <1..>607 FT /codon_start=1 FT /gene="RAG1" FT /product="recombination activating protein 1" FT /db_xref="GOA:A0A2H4W8F1" FT /db_xref="InterPro:IPR001841" FT /db_xref="InterPro:IPR013083" FT /db_xref="InterPro:IPR017907" FT /db_xref="InterPro:IPR018957" FT /db_xref="InterPro:IPR019485" FT /db_xref="InterPro:IPR024627" FT /db_xref="InterPro:IPR035714" FT /db_xref="InterPro:IPR036236" FT /db_xref="UniProtKB/TrEMBL:A0A2H4W8F1" FT /protein_id="AUC63242.1" FT /translation="SSEVYFPRNNAVEWKPHCSKCDVCSSSKNWSKRKTTLHQNCLIKK FT RKLNVEHRKKNKSGKMSPLWKKTRTLNQIRNKCKQIHLDSNLLVVDYPSDFTKSFTCQV FT CEHILSDPVQTSCKHLFCRICILKYFKIMGCYCPSCRHTCFPTDLAPPVKSFLNILNSL FT VLKCAVTGCDEEILLGKYSQHIAKHKEIKGKDAYAPINK" XX SQ Sequence 607 BP; 196 A; 133 C; 118 G; 159 T; 1 other; tccagtgagg tttattttcc ccgtaacaat gcggtggagt ggaagcctca ctgttccaaa 60 tgtgatgttt gcagttcctc caaaaattgg agtaagagaa agacaacatt gcaccaaaac 120 tgtcttatca aaaagaggaa actcaatgtg gaacatagaa agaaaaacaa aagtggaaaa 180 atgtcccctc tctggaagaa gactaggacc ctgaatcaaa tcaggaacaa gtgcaaacaa 240 atccaccttg attccaactt actggttgtt gactatcctt ccgattttac gaagtcgttc 300 acatgccagg tgtgtgagca catattgtct gatccagtgc aaacctcatg caaacatttg 360 ttctgcagga tttgcatcct caaatatttc aagattatgg gttgctactg cccatcttgc 420 agacacactt gcttcccaac ggatctggca ccacccgtga agtcatttct taacatttta 480 aactccttgg tcttaaagtg cgcagtgact ggatgtgatg aggaaatcct gctwggaaaa 540 tactcccaac atattgctaa acataaagaa atcaaaggta aagatgctta tgcccctatc 600 aacaaag 607 //