ID KY962772; SV 1; linear; genomic DNA; STD; VRT; 588 BP. XX AC KY962772; XX DT 20-DEC-2017 (Rel. 135, Created) DT 29-JUN-2018 (Rel. 137, Last updated, Version 5) XX DE Pristimantis bounides voucher NMP6V75540 recombination activating protein 1 DE (RAG1) gene, partial cds. XX KW . XX OS Pristimantis bounides (hill dweller rubber frog) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; OC Batrachia; Anura; Neobatrachia; Hyloidea; Strabomantidae; Pristimantis. XX RN [1] RC Publication Status: Online-Only RP 1-588 RX PUBMED; 29187793. RA Lehr E., von May R., Moravec J., Cusi J.C.; RT "A new species of Phrynopus (Amphibia, Anura, Craugastoridae) from upper RT montane forests and high Andean grasslands of the Pui Pui Protected Forest RT in central Peru"; RL J. Anim. Genet. Zookeys(713):131-157(2017). XX RN [2] RP 1-588 RA von May R., Lehr E.; RT ; RL Submitted (17-APR-2017) to the INSDC. RL Ecology and Evolutionary Biology, University of Michigan, 2051 Ruthven RL Museums Building, 1109 Geddes Ave., Ann Arbor, MI 48109, USA XX DR MD5; 4fdb747b64ed55f990659285d79e4ad5. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..588 FT /organism="Pristimantis bounides" FT /mol_type="genomic DNA" FT /country="Peru:Junin, Sector Carrizal, Carrtera FT Satipo-Toldopampa, km 134" FT /lat_lon="11.48 S 74.89 W" FT /specimen_voucher="NMP6V75540" FT /collected_by="E. Lehr, J. Moravec, J.C. Cusi" FT /collection_date="23-Jun-2013" FT /db_xref="taxon:2058353" FT /altitude="3350m" FT /type_material="paratype of Pristimantis bounides" FT gene <1..>588 FT /gene="RAG1" FT mRNA <1..>588 FT /gene="RAG1" FT /product="recombination activating protein 1" FT CDS <1..>588 FT /codon_start=1 FT /gene="RAG1" FT /product="recombination activating protein 1" FT /db_xref="GOA:A0A2H4W8F9" FT /db_xref="InterPro:IPR001841" FT /db_xref="InterPro:IPR013083" FT /db_xref="InterPro:IPR017907" FT /db_xref="InterPro:IPR018957" FT /db_xref="InterPro:IPR019485" FT /db_xref="InterPro:IPR024627" FT /db_xref="InterPro:IPR035714" FT /db_xref="InterPro:IPR036236" FT /db_xref="UniProtKB/TrEMBL:A0A2H4W8F9" FT /protein_id="AUC63240.1" FT /translation="YFPRNNAVEWKPHCSKCDVCSSSKNWSKRKTTLHQNCLIKKRKLN FT VEHRKKNKSGKMSPLWKKTRTLNQIRNKCKQIHLDSNLLVVDYPSDFTKSFTCQVCEHI FT LSDPVQTSCKHLFCRICILKYFKIMGCYCPSCRHTCFPTDLAPPVKSFLNILNSLVLKC FT AVTGCDEEILLGKYSQHIAKHKEIKGKDAYAPI" XX SQ Sequence 588 BP; 189 A; 129 C; 113 G; 156 T; 1 other; tattttcccc gtaacaatgc ggtggagtgg aagcctcact gttccaaatg tgatgtttgc 60 agttcctcca aaaattggag taagagaaag acaacattgc accaaaaytg tcttatcaaa 120 aagaggaaac tcaatgtgga acatagaaag aaaaacaaaa gtggaaaaat gtcccctctc 180 tggaagaaga ctaggaccct gaatcaaatc aggaacaagt gcaaacaaat ccaccttgat 240 tccaacttac tggttgttga ctatccttcc gattttacga agtcgttcac atgccaggtg 300 tgtgagcaca tattgtctga tccagtgcaa acctcatgca aacatttgtt ctgcaggatt 360 tgcatcctca aatatttcaa gattatgggt tgctactgcc catcttgcag acacacttgc 420 ttcccaacgg atctggcacc acccgtgaag tcatttctta acattttaaa ctccttggtc 480 ttaaagtgcg cagtgactgg atgtgatgag gaaatcctgc ttggaaaata ctcccaacat 540 attgctaaac ataaagaaat caaaggtaaa gatgcttatg cccctatc 588 //