ID KY962771; SV 1; linear; genomic DNA; STD; VRT; 622 BP. XX AC KY962771; XX DT 20-DEC-2017 (Rel. 135, Created) DT 29-JUN-2018 (Rel. 137, Last updated, Version 5) XX DE Pristimantis bounides voucher MUSM31198 recombination activating protein 1 DE (RAG1) gene, partial cds. XX KW . XX OS Pristimantis bounides (hill dweller rubber frog) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; OC Batrachia; Anura; Neobatrachia; Hyloidea; Strabomantidae; Pristimantis. XX RN [1] RC Publication Status: Online-Only RP 1-622 RX PUBMED; 29187793. RA Lehr E., von May R., Moravec J., Cusi J.C.; RT "A new species of Phrynopus (Amphibia, Anura, Craugastoridae) from upper RT montane forests and high Andean grasslands of the Pui Pui Protected Forest RT in central Peru"; RL J. Anim. Genet. Zookeys(713):131-157(2017). XX RN [2] RP 1-622 RA von May R., Lehr E.; RT ; RL Submitted (17-APR-2017) to the INSDC. RL Ecology and Evolutionary Biology, University of Michigan, 2051 Ruthven RL Museums Building, 1109 Geddes Ave., Ann Arbor, MI 48109, USA XX DR MD5; 4ae703a01041ff041d2f52114746c379. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..622 FT /organism="Pristimantis bounides" FT /mol_type="genomic DNA" FT /country="Peru:Junin, Quebrada Tasta, ''Runda'', distrubed FT area with Ichu, mosses, and bushes next to a forest patch, FT found in center of sedge, rain" FT /lat_lon="11.45 S 74.89 W" FT /specimen_voucher="MUSM31198" FT /collected_by="E. Lehr & R. von May" FT /collection_date="19-May-2012" FT /db_xref="taxon:2058353" FT /altitude="3463m" FT /type_material="paratype of Pristimantis bounides" FT gene <1..>622 FT /gene="RAG1" FT mRNA <1..>622 FT /gene="RAG1" FT /product="recombination activating protein 1" FT CDS <1..>622 FT /codon_start=1 FT /gene="RAG1" FT /product="recombination activating protein 1" FT /db_xref="GOA:A0A2H4W8G4" FT /db_xref="InterPro:IPR001841" FT /db_xref="InterPro:IPR013083" FT /db_xref="InterPro:IPR017907" FT /db_xref="InterPro:IPR018957" FT /db_xref="InterPro:IPR019485" FT /db_xref="InterPro:IPR024627" FT /db_xref="InterPro:IPR035714" FT /db_xref="InterPro:IPR036236" FT /db_xref="UniProtKB/TrEMBL:A0A2H4W8G4" FT /protein_id="AUC63239.1" FT /translation="KFNNSSSEVYFPRNNAVEWKPHCSKCDVCSSSKNWSKRKTTLHQN FT CLIKKRKLNVEHKKKNKSGKMSPLWKKTRTLNQIRNKCKQIHLDSNLLVVDYPSDFTKS FT FTCQVCEHILSDPVQTSCKHLFCRICILKYFKIMGCYCPSCRHTCFPTDLAPPVKSFLN FT ILNSLVLKCAVTGCDEEILLGKYSQHIAKHKEIKGKDAYAPINK" XX SQ Sequence 622 BP; 204 A; 135 C; 116 G; 161 T; 6 other; aaattcaaca attcctccag tgaggtttat tttccccgta acaatgcggt ggagtggaag 60 cctcactgtt ccaaatgtga tgtttgcagt tcctccaaaa attggagtaa gagaaagaca 120 acattgcacc aaaactgyct tatcaaaaag aggaaactca atgtggaaca taaaaagaaa 180 aacaaaagtg gaaaratgtc ccctctctgg aagaagacta ggaccctgaa tcaaatcagg 240 aacaagtgca aacaaatcca cctygattcc aayttactgg ttgttgacta tccttccgat 300 tttacraagt cgttcacatg ccaggtgtgt gagcacatat tgtctgatcc agtgcaaacy 360 tcatgcaaac atttgttctg caggatttgc atcctcaaat atttcaagat tatgggttgc 420 tactgcccat cttgcagaca cacttgcttc ccaacggatc tggcaccacc cgtgaagtca 480 tttcttaaca ttttaaactc cttggtctta aagtgcgcag tgactggatg tgatgaggaa 540 atcctgctag gaaaatactc ccaacatatt gctaaacata aagaaatcaa aggtaaagat 600 gcttatgccc ctatcaacaa ag 622 //