ID KY856937; SV 1; linear; genomic DNA; STD; INV; 219 BP. XX AC KY856937; XX DT 25-MAR-2018 (Rel. 136, Created) DT 25-MAR-2018 (Rel. 136, Last updated, Version 1) XX DE Spongia officinalis cytochrome c oxidase subunit 1 gene, partial cds; DE mitochondrial. XX KW . XX OS Spongia officinalis (commercial sponge) OC Eukaryota; Metazoa; Porifera; Demospongiae; Keratosa; Dictyoceratida; OC Spongiidae; Spongia. OG Mitochondrion XX RN [1] RP 1-219 RA Castritsi-Catharios J., Zaoutsos S.P., Berillis P., Zouganelis G.D., RA Ekonomou G., Kefalas E., Pantelis J.; RT "Kalymnos, the island which made history in sponge fishery. Data on RT physical parameters, elemental composition and DNA barcode preliminary RT results of the most common bath sponge species in Aegean Sea"; RL Unpublished. XX RN [2] RP 1-219 RA Zouganelis G.; RT ; RL Submitted (30-MAR-2017) to the INSDC. RL Applied Science, Bournemouth & Poole College, 2C Bellevue Road, Poole BH14 RL 8TW, United Kingdom XX DR MD5; 57cf8b86dc391a23da475c502420394d. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..219 FT /organism="Spongia officinalis" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /country="Greece" FT /db_xref="taxon:252964" FT CDS <1..>219 FT /codon_start=2 FT /transl_table=4 FT /product="cytochrome c oxidase subunit 1" FT /EC_number="1.9.3.1" FT /db_xref="GOA:A0A2P1IUL3" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023615" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A2P1IUL3" FT /protein_id="AVN89836.1" FT /translation="HLFWFFGHPEVYVLILPGFGIVSQVIVVFSKKQIFGYLGMVYAMV FT SIGILGFIVWAHHMFTVGMDVDTRAYFT" XX SQ Sequence 219 BP; 47 A; 28 C; 59 G; 85 T; 0 other; acacttattt tggttttttg ggcatccaga ggtttatgtt ttaattttgc cgggattcgg 60 gatagtttct caagtaatcg tggtatttag taaaaagcaa atattcgggt atttggggat 120 ggtgtatgcc atggtgtcta tcggtatatt gggattcatt gtatgggccc atcatatgtt 180 tactgtgggt atggatgttg atacccgggc gtattttac 219 //