ID KY652816; SV 1; linear; genomic DNA; STD; INV; 630 BP. XX AC KY652816; XX DT 09-APR-2018 (Rel. 136, Created) DT 09-APR-2018 (Rel. 136, Last updated, Version 2) XX DE Corallistes floreana voucher HBOM 003-02000 cytochrome c oxidase subunit 1 DE (cox1) gene, partial cds; mitochondrial. XX KW . XX OS Corallistes floreana OC Eukaryota; Metazoa; Porifera; Demospongiae; Heteroscleromorpha; OC Tetractinellida; Astrophorina; Corallistidae; Corallistes. OG Mitochondrion XX RN [1] RC Publication Status: Available-Online prior to print RP 1-630 RA Schuster A., Cardenas P., Pisera A., Pomponi S.A., Kelly M., Woerheide G., RA Erpenbeck D.; RT "Seven new deep-water Tetractinellida (Porifera: Demospongiae) from the RT Galapagos Islands - morphological descriptions and DNA barcodes"; RL Zool. J. Linn. Soc. 0:0(2018). XX RN [2] RP 1-630 RA Schuster A.; RT ; RL Submitted (22-FEB-2017) to the INSDC. RL Earth and Environmental Sciences Paleontology & Geobiology, RL Ludwig-Maximilians-Universitat Munchen, Richard-Wagner-Str. 10, Munich, RL Bavaria 80333, Germany XX DR MD5; b79e095bea1fe9076691e3307a44105a. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..630 FT /organism="Corallistes floreana" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /country="Ecuador:Galapagos, Santa Maria Island" FT /specimen_voucher="HBOM 003-02000" FT /identified_by="A. Schuster" FT /db_xref="taxon:2137258" FT /type_material="holotype of Corallistes floreana" FT gene <1..>630 FT /gene="cox1" FT CDS <1..>630 FT /codon_start=1 FT /transl_table=4 FT /gene="cox1" FT /product="cytochrome c oxidase subunit 1" FT /db_xref="GOA:A0A2R4FBW2" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A2R4FBW2" FT /protein_id="AVT28015.1" FT /translation="MIGTGFSFLIRLELSAPGSMLGDDHLYNVIITAHGLIMIFFLVMP FT VLIGGFGNWFVPLYIGAPDMAFPRLNNISFWVLPPSLILLLGSAFVEQGVGAGWTLYPP FT LSSVQAHSGGSVDAAIFSLHLAGISSILGSMNFITTIFNMRAPGITMDRLPLFVWSILV FT TTYLLILSLPVLAGAITMLLTDRNFNTTFFDPAGGGDPILFQHLFWF" XX SQ Sequence 630 BP; 149 A; 120 C; 131 G; 230 T; 0 other; atgataggga ccggattcag ttttcttatt agacttgaat tatcagcccc cggatcaatg 60 ctaggggatg atcatcttta taatgttata ataacagctc acggccttat aatgattttc 120 ttcttagtta tgccagtttt gatagggggg tttggaaatt gatttgtgcc cctctatatc 180 ggggccccgg atatggcctt tccaagacta aataacatta gtttttgagt cttacccccg 240 tcattaatat tattattggg ctcagctttt gttgaacaag gggtaggtgc cggatggact 300 ctttatcctc ctttatcaag tgttcaagcc cattcagggg gatctgtaga tgcggcaata 360 tttagtcttc atttggccgg tatatcctca atcttagggt ctatgaattt tattactact 420 atttttaata tgcgagctcc cggtatcacg atggatagat tgcctttgtt tgtttgatct 480 attttagtta caacttatct tttaatatta tctctgcccg tattggcggg cgcaataact 540 atgcttttaa cggatagaaa ttttaataca actttcttcg acccggcggg tggcggggac 600 ccaatattat ttcagcattt attctggttc 630 //