ID KX144853; SV 1; linear; genomic DNA; STD; INV; 253 BP. XX AC KX144853; XX DT 28-JUL-2016 (Rel. 129, Created) DT 28-JUL-2016 (Rel. 129, Last updated, Version 1) XX DE Zwicknia ledoarei voucher NHMO-EPT_37225 cytochrome oxidase subunit 1 (COI) DE gene, partial cds; mitochondrial. XX KW . XX OS Zwicknia ledoarei OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Polyneoptera; Plecoptera; Nemouroidea; Capniidae; Zwicknia. OG Mitochondrion XX RN [1] RC Publication Status: Online-Only RP 1-253 RX DOI; 10.11646/zootaxa.4121.2.3. RX PUBMED; 27395213. RA Reding J.P., Launay B., Ruffoni A., Vincon G., Boumans L.; RT "A new species of Zwicknia Muranyi (Plecoptera, Capniidae) from the French RT and Swiss Jura Mountains, the French Massif Central, and the French Middle RT Rhone Region"; RL Zootaxa 4121(2):133-146(2016). XX RN [2] RP 1-253 RA Reding J.-P.G., Launay B., Ruffoni A., Vincon G., Boumans L.; RT ; RL Submitted (26-APR-2016) to the INSDC. RL Jean-Paul G. Reding, Jean-Paul G. Reding, 2, Petit-Berne, Corcelles, Bern RL CH 2035, Switzerland XX DR MD5; 29483e4fee45d5706d2cdfcebfd1aba4. XX FH Key Location/Qualifiers FH FT source 1..253 FT /organism="Zwicknia ledoarei" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /country="Switzerland:Vaud, Sainte-Croix, Saut de l'Eau" FT /lat_lon="46.84 N 6.51 E" FT /specimen_voucher="NHMO-EPT_37225" FT /collected_by="J.P. Reding" FT /collection_date="12-May-2014" FT /identified_by="J. P. Reding" FT /db_xref="taxon:1874873" FT gene <1..>253 FT /gene="COI" FT CDS <1..>253 FT /codon_start=3 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A1B1R5V9" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A1B1R5V9" FT /protein_id="ANT97179.1" FT /translation="LYFIFGAWAGMVGTSLSLLIRAELGQPGSLIGDDQIYNVIVTAHA FT FVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMS" XX SQ Sequence 253 BP; 72 A; 40 C; 49 G; 92 T; 0 other; ctttatactt catctttgga gcttgagcag gaatagttgg aacgtcttta agtttattaa 60 ttcgagctga attaggccaa ccaggctcac taattggaga tgaccaaatt tataatgtaa 120 ttgttacagc tcatgcgttt gtaatgattt tttttatagt tatacctatt ataattgggg 180 gtttcggaaa ctgacttgtt cctttaatgc ttggagcacc agatatggct ttcccccgaa 240 taaataatat aag 253 //