ID KU852349; SV 1; linear; genomic DNA; STD; FUN; 796 BP. XX AC KU852349; XX DT 05-DEC-2017 (Rel. 135, Created) DT 05-DEC-2017 (Rel. 135, Last updated, Version 2) XX DE Suillus sibiricus voucher HKAS:91415 DNA-directed RNA polymerase II subunit DE two (rpb2) gene, partial cds. XX KW . XX OS Suillus sibiricus OC Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina; Agaricomycetes; OC Agaricomycetidae; Boletales; Suillineae; Suillaceae; Suillus. XX RN [1] RP 1-796 RA Zhang R., Shi X.-F., Mueller G.M., Liu P.-G.; RT "Dilemmatic Calibration of Evolutionary History in the Genus Suillus RT (Boletales, Basidiomycota) Revealed by Host Association Analysis"; RL Unpublished. XX RN [2] RP 1-796 RA Zhang R., Shi X.-F., Mueller G.M., Liu P.-G.; RT ; RL Submitted (29-FEB-2016) to the INSDC. RL Key Laboratory for Plant Diversity and Biogeography of East Asia, Kunming RL Institute of Botany, Chinese Academy of Sciences, No. 132 Lanhei Road, RL Heilongtan, Kunming, Yunnan 650201, China XX DR MD5; 4d7a22e8d0cd8d950ff3163732f60234. XX CC ##Assembly-Data-START## CC Assembly Method :: Mesquite v. 3.02 CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..796 FT /organism="Suillus sibiricus" FT /host="pinus armandii" FT /mol_type="genomic DNA" FT /country="China:Sichuan province, Daqing Mt., Huili Xian" FT /isolation_source="sporocarp" FT /specimen_voucher="HKAS:91415" FT /specimen_voucher="RZ07291202" FT /collected_by="Rui Zhang" FT /collection_date="29-Jul-2012" FT /db_xref="taxon:48584" FT /altitude="2105m" FT gene <1..>796 FT /gene="rpb2" FT mRNA join(<1..714,760..>796) FT /gene="rpb2" FT /product="DNA-directed RNA polymerase II subunit two" FT CDS join(<1..714,760..>796) FT /codon_start=1 FT /gene="rpb2" FT /product="DNA-directed RNA polymerase II subunit two" FT /db_xref="GOA:A0A2H4H270" FT /db_xref="InterPro:IPR007645" FT /db_xref="InterPro:IPR007646" FT /db_xref="InterPro:IPR007647" FT /db_xref="InterPro:IPR015712" FT /db_xref="InterPro:IPR037033" FT /db_xref="UniProtKB/TrEMBL:A0A2H4H270" FT /protein_id="ARI48302.1" FT /translation="WGMVCPAETPEGQACGLVKNLALMACISVGSYSAPVIEFLEEWGL FT ESLEENAHSSTPCTKVFVNGVWMGVHRDPANLVKTIKKLRRKDDISPEVSVVRDIRERE FT LRLYTDAGRVCRPLFIVENQQLALQKKHIKWLNQGYRDEDGEEFKWEQLVKNGIIELLD FT AEEEETVMICMTPEDLENSRLQSAGIDPHQNDGDYDPAARLKAGISAHTWTHCEIHPSM FT ILGVCASIIPFPDHNQSPRNTYQSAMGK" XX SQ Sequence 796 BP; 191 A; 176 C; 225 G; 202 T; 2 other; tggggtatgg tgtgtcctgc cgaaacgcca gaagggcagg cttgtggtct cgtcaagaat 60 ctcgccctca tggcatgtat ctcagtcggt tcttattccg cgcccgtcat cgagttcttg 120 gaggagtggg gtcttgaatc actggaggag aatgcgcact cgtcgacgcc ttgtacgaag 180 gtctttgtca atggtgtctg gatgggtgtg catcgtgacc ccgcgaatct cgtgaagacr 240 atyaagaagc ttcgtaggaa ggatgatatc agtcctgaag tctctgttgt tcgcgatatc 300 cgtgagcggg agctgcgatt atacacagac gctggtcgtg tctgccgacc gctattcatc 360 gtcgagaatc agcagctcgc ccttcaaaag aagcatatca aatggttgaa ccaaggttat 420 cgcgacgaag acggagagga atttaagtgg gagcagctag taaaaaatgg aatcatcgag 480 ttgttggatg cggaggaaga agagactgtc atgatctgta tgactccgga ggacctcgag 540 aactccagat tacagtcagc gggtattgat cctcaccaga atgatggcga ttatgaccca 600 gctgcacggc tgaaggcagg gatcagcgcg catacttgga ctcactgtga gattcaccca 660 agcatgattc tgggtgtctg tgcgagtatc attcctttcc ctgaccacaa ccaggtgagt 720 ggtatgcttt ttctgtgtat gaaagttgac cgtttgtagt ctcctcgtaa tacctatcaa 780 tctgcaatgg gtaaac 796 //