ID KT782761; SV 1; linear; genomic DNA; STD; INV; 658 BP. XX AC KT782761; XX DT 19-MAY-2016 (Rel. 128, Created) DT 19-MAY-2016 (Rel. 128, Last updated, Version 1) XX DE Drilliidae sp. PJF-2016a voucher MNHN-IM-2013-9092 cytochrome oxidase DE subunit 1 (COI) gene, partial cds; mitochondrial. XX KW . XX OS Drilliidae sp. PJF-2016a OC Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca; Gastropoda; OC Caenogastropoda; Neogastropoda; Conoidea; Drilliidae. OG Mitochondrion XX RN [1] RP 1-658 RX DOI; 10.11646/zootaxa.4090.1.1. RX PUBMED; 27394363. RA Fallon P.J.; RT "Taxonomic review of tropical western Atlantic shallow water Drilliidae RT (Mollusca: Gastropoda: Conoidea) including descriptions of 100 new RT species"; RL Zootaxa 4090(1):1-363(2016). XX RN [2] RP 1-658 RA Fallon P.J.; RT ; RL Submitted (20-SEP-2015) to the INSDC. RL Biology, Academy of Natural Sciences of Drexel University, 77 Cedar Drive, RL Farmingdale, NY 11735, USA XX DR MD5; 5f0688887ad49937f93ca717d14409f6. XX FH Key Location/Qualifiers FH FT source 1..658 FT /organism="Drilliidae sp. PJF-2016a" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /country="Guadeloupe:Anse Tarare" FT /lat_lon="16.27 N 61.17 W" FT /specimen_voucher="MNHN-IM-2013-9092" FT /collected_by="MNHN Rec.MNHN-IRD" FT /identified_by="P. Fallon" FT /db_xref="taxon:1848317" FT gene <1..>658 FT /gene="COI" FT CDS <1..>658 FT /codon_start=2 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A172QDA1" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A172QDA1" FT /protein_id="AND82262.1" FT /translation="TLYILFGMWSGLVGTALSLLIRAELGQPGALLGDDQLYNVIVTAH FT AFVMIFFLVMPMMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLLLLLSSAAVES FT GAGTGWTVYPPLAGNLAHAGGSVDLAIFSLHLAGASSILGAVNFITTIINMRWQGMQFE FT RLPLFVWSVKITAILLLLSLPVLAGAITMLLTDRNFNTAFFDPAGGGDPILYQHLF" XX SQ Sequence 658 BP; 177 A; 104 C; 124 G; 253 T; 0 other; aacgttatat attttatttg gaatatgatc aggactagtt ggaactgcat tgagattatt 60 aattcgagct gaattaggtc aacctggtgc attacttggt gatgatcaat tatataatgt 120 aatcgttacg gcacatgcat ttgtaatgat ttttttctta gttataccta taatgattgg 180 aggttttgga aactgattgg tacctttaat attaggagct cctgatatag cttttccacg 240 attaaataac ataagttttt ggcttttacc cccttcttta ttattattat tgtcatcggc 300 tgctgtggaa aggggagctg gtacaggatg aacagtttac ccacctttgg ctggaaatct 360 agcacacgct ggtggctcag tagacctagc tattttctct ttacatcttg caggtgcttc 420 atctatttta ggtgcagtaa atttcattac tactattatt aatatacgat gacaaggaat 480 acaatttgag cgacttcctt tatttgtatg atctgtaaag attacagcta ttttgttatt 540 attatctttg cctgtacttg ctggagcgat tacaatatta ttaactgatc gaaattttaa 600 tactgcattt tttgatcctg cgggaggtgg agatcctatt ttatatcaac acctgttt 658 //