ID KT601567; SV 1; linear; genomic DNA; STD; VRT; 352 BP. XX AC KT601567; XX DT 11-DEC-2015 (Rel. 127, Created) DT 29-JUN-2018 (Rel. 137, Last updated, Version 3) XX DE Hemidactylus yajurvedi isolate CES12007 phosducin gene, partial cds. XX KW . XX OS Hemidactylus yajurvedi (Kanker rock gecko) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Lepidosauria; Squamata; Bifurcata; Gekkota; Gekkonidae; Gekkoninae; OC Hemidactylus. XX RN [1] RC Publication Status: Online-Only RP 1-352 RX DOI; 10.11646/zootaxa.4021.2.5. RX PUBMED; 26624132. RA Murthy B.H., Bauer A., Lajmi A., Agarwal I., Giri V.B.; RT "A new rock dwelling Hemidactylus (Squamata: Gekkonidae) from Chhattisgarh, RT India"; RL Zootaxa 4021(2):334-350(2015). XX RN [2] RP 1-352 RA Murthy B.H.C.K., Bauer A., Lajmi A., Agarwal I., Giri V.B.; RT ; RL Submitted (31-AUG-2015) to the INSDC. RL Centre for Ecological Sciences, Indian Institute of Science, C.V. Raman RL Road, Bangalore, Karnataka 560012, India XX DR MD5; e683278646f37d01fe51d66dd07feef9. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..352 FT /organism="Hemidactylus yajurvedi" FT /isolate="CES12007" FT /mol_type="genomic DNA" FT /db_xref="taxon:1766037" FT mRNA <1..>352 FT /product="phosducin" FT CDS <1..>352 FT /codon_start=1 FT /product="phosducin" FT /db_xref="InterPro:IPR001200" FT /db_xref="InterPro:IPR024253" FT /db_xref="InterPro:IPR036249" FT /db_xref="UniProtKB/TrEMBL:A0A0S3J2S1" FT /protein_id="ALR72599.1" FT /translation="YRKRCMQDMHQRLSFGPRYGNLSXLQSGEQFLETIEKERKTTTVI FT VHIYEDGVKGCDLLNNSLACLAAEYSXVRFCKIKASNTGAEDRFSSDVLPTLLVYRGGE FT LVSNFLSVTEQFN" XX SQ Sequence 352 BP; 88 A; 78 C; 96 G; 88 T; 2 other; tatcggaagc gctgtatgca ggacatgcac cagaggctga gctttgggcc taggtatggc 60 aacctctcar agctccagag tggggagcag ttcctggaga ccattgagaa ggagaggaaa 120 accactaccg tcattgtcca catttatgaa gatggtgtca agggctgtga tttactcaac 180 aacagtttgg cctgtcttgc tgccgaatat agcakggtga ggttttgcaa gatcaaggcc 240 tctaacacgg gggccgaaga ccgtttctct tccgatgtcc tcccgacact tcttgtctac 300 agaggtgggg agcttgtaag caatttctta agtgtaactg aacagttcaa tg 352 //