ID KT601565; SV 1; linear; genomic DNA; STD; VRT; 287 BP. XX AC KT601565; XX DT 11-DEC-2015 (Rel. 127, Created) DT 29-JUN-2018 (Rel. 137, Last updated, Version 3) XX DE Hemidactylus yajurvedi isolate CES12007 cytochrome b gene, partial cds; DE mitochondrial. XX KW . XX OS Hemidactylus yajurvedi (Kanker rock gecko) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Lepidosauria; Squamata; Bifurcata; Gekkota; Gekkonidae; Gekkoninae; OC Hemidactylus. OG Mitochondrion XX RN [1] RC Publication Status: Online-Only RP 1-287 RX DOI; 10.11646/zootaxa.4021.2.5. RX PUBMED; 26624132. RA Murthy B.H., Bauer A., Lajmi A., Agarwal I., Giri V.B.; RT "A new rock dwelling Hemidactylus (Squamata: Gekkonidae) from Chhattisgarh, RT India"; RL Zootaxa 4021(2):334-350(2015). XX RN [2] RP 1-287 RA Murthy B.H.C.K., Bauer A., Lajmi A., Agarwal I., Giri V.B.; RT ; RL Submitted (31-AUG-2015) to the INSDC. RL Centre for Ecological Sciences, Indian Institute of Science, C.V. Raman RL Road, Bangalore, Karnataka 560012, India XX DR MD5; a210590d8fc49a4c7eb3bafd80a92116. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..287 FT /organism="Hemidactylus yajurvedi" FT /organelle="mitochondrion" FT /isolate="CES12007" FT /mol_type="genomic DNA" FT /db_xref="taxon:1766037" FT CDS <1..>287 FT /codon_start=1 FT /transl_table=2 FT /product="cytochrome b" FT /db_xref="GOA:A0A0S3J2V7" FT /db_xref="InterPro:IPR005797" FT /db_xref="InterPro:IPR016174" FT /db_xref="InterPro:IPR027387" FT /db_xref="UniProtKB/TrEMBL:A0A0S3J2V7" FT /protein_id="ALR72597.1" FT /translation="FGSLLGLCLITQITTGLFLAMHYTADTTLAFTSIAHICRDVQYGW FT LIRNTHANGASMFFICLYLHIGRGVYYGSYLYKETWNTGIIMLFLTMATA" XX SQ Sequence 287 BP; 88 A; 83 C; 46 G; 70 T; 0 other; ttcggctcat tactcgggct atgtctaatc acacaaatta ccaccggcct gttcctagca 60 atacactaca ctgccgacac aacactagct tttacctcaa tcgcccacat ctgtcgagat 120 gtacagtacg gctgattaat ccgaaacacc cacgccaacg gcgcatcaat attcttcatc 180 tgtctatacc tgcacatcgg acgaggagta tactacgggt catacctata caaagagaca 240 tgaaacacag gaattattat actattccta acaatagcca cagcgtt 287 //