ID KP684929; SV 1; linear; genomic DNA; STD; INV; 221 BP. XX AC KP684929; XX DT 20-MAY-2015 (Rel. 124, Created) DT 20-MAY-2015 (Rel. 124, Last updated, Version 1) XX DE Serromyia diabolica voucher LBXX20 cytochrome oxidase subunit I (COI) gene, DE partial cds; mitochondrial. XX KW . XX OS Serromyia diabolica OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Diptera; Nematocera; Chironomoidea; OC Ceratopogonidae; Ceratopogoninae; Serromyia. OG Mitochondrion XX RN [1] RC Publication Status: Online-Only RP 1-221 RX DOI; 10.11646/zootaxa.3946.3.10. RX PUBMED; 25947703. RA Dominiak P., Mathieu B.; RT "Serromyia diabolica, a new biting midge species from Lebanon (Diptera: RT Ceratopogonidae)"; RL Zootaxa 3946(3):436-444(2015). XX RN [2] RP 1-221 RA Mathieu B., Dominiak P.; RT ; RL Submitted (21-JAN-2015) to the INSDC. RL Entomology, Institute of Parasitology and Tropical Pathology - Medicine RL Faculty, 3 rue Koeberle, Strasbourg 67000, France XX DR MD5; e8f316c7b57be4a84366337c4aac55f6. XX FH Key Location/Qualifiers FH FT source 1..221 FT /organism="Serromyia diabolica" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /country="Lebanon" FT /lat_lon="33.92 N 36.26 E" FT /specimen_voucher="LBXX20" FT /collection_date="05-May-2012" FT /identified_by="P. Dominiak" FT /PCR_primers="fwd_name: C1J1936, fwd_seq: FT cttcatttagccggaatttct, rev_name: HCO2198, rev_seq: FT taaacttcagggtgaccaaaaaatca" FT /db_xref="taxon:1653289" FT gene <1..>221 FT /gene="COI" FT CDS <1..>221 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit I" FT /db_xref="GOA:A0A0F7DE16" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0F7DE16" FT /protein_id="AKG96862.1" FT /translation="LHLAGISFDRMPLFVWSVLITAILLLLSLPVLAGAITMLLTDRNI FT NTSFFDPAGGGDPILYQHLFWFFGHPEV" XX SQ Sequence 221 BP; 58 A; 39 C; 32 G; 92 T; 0 other; cttcatttag ccggaatttc ttttgatcga ataccattat ttgtgtgatc tgtcttaatt 60 actgcaattt tattgttatt atcattacct gttcttgctg gagcaattac aatattatta 120 acagatcgaa atattaatac ctcatttttc gaccccgcag gaggtggaga tcctattcta 180 tatcaacatt tattttgatt ttttggtcac cctgaagttt a 221 //