ID   KM668330; SV 1; linear; genomic DNA; STD; INV; 625 BP.
XX
AC   KM668330;
XX
DT   22-OCT-2014 (Rel. 122, Created)
DT   28-JAN-2017 (Rel. 131, Last updated, Version 2)
XX
DE   Uradolichos rotunda voucher 06.AU.WA.OPS.03 elongation factor 1-alpha
DE   (EF1a) gene, partial cds.
XX
KW   .
XX
OS   Uradolichos rotunda
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota;
OC   Neoptera; Paraneoptera; Hemiptera; Auchenorrhyncha; Cicadoidea; Cicadidae;
OC   Cicadettinae; Cicadettini; Uradolichos.
XX
RN   [1]
RC   Publication Status: Available-Online prior to print
RP   1-625
RX   PUBMED; 25091217.
RA   Owen C.L., Marshall D.C., Hill K.B., Simon C.;
RT   "The phylogenetic utility of acetyltransferase (ARD1) and glutaminyl tRNA
RT   synthetase (QtRNA) for reconstructing Cenozoic relationships as exemplified
RT   by the large Australian cicada Pauropsalta generic complex";
RL   Mol. Phylogenet. Evol. 0:0(2014).
XX
RN   [2]
RP   1-625
RA   Owen C.L., Marshall D.C., Hill K.B.R., Simon C.;
RT   ;
RL   Submitted (29-SEP-2014) to the INSDC.
RL   EEB, University of Connecticut, 75 N. Eagleville Road, Unit 3043, Storrs,
RL   CT 06269-3043, USA
XX
DR   MD5; 857d3aee9bd89465c23d3c29a8fd5b10.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..625
FT                   /organism="Uradolichos rotunda"
FT                   /mol_type="genomic DNA"
FT                   /country="Australia"
FT                   /specimen_voucher="06.AU.WA.OPS.03"
FT                   /db_xref="taxon:1540198"
FT   gene            <1..>625
FT                   /gene="EF1a"
FT   mRNA            join(<1..23,110..289,516..>625)
FT                   /gene="EF1a"
FT                   /product="elongation factor 1-alpha"
FT   CDS             join(<1..23,110..289,516..>625)
FT                   /codon_start=3
FT                   /gene="EF1a"
FT                   /product="elongation factor 1-alpha"
FT                   /db_xref="GOA:A0A097IAW7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A097IAW7"
FT                   /protein_id="AIT59224.1"
FT                   /translation="FEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYY
FT                   VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV
FT                   "
XX
SQ   Sequence 625 BP; 183 A; 93 C; 138 G; 210 T; 1 other;
     agtttgagaa ggaagcccag gaggtgagaa agtttctagt tgcgcaagta acactcagta        60
     cgatgttttt ctgcccataa gttattaata taatatttgt aatttctaga tgggaaaagg       120
     atccttcaaa tatgcctggg ttttggacaa gctaaaagca gaacgtgaac gtggtatcac       180
     aattgatatt gctttatgga agtttgaaac ygccaaatat tatgtaacca ttattgacgc       240
     ccctggacat agagatttca tcaagaacat gatcactgga acatcacagg tcagtgtgaa       300
     atgtgttgtt tagaacagcc tttgtttttg cattgtaata tttggttaag ggcgttcaaa       360
     tcaatttgaa attttcatgc ttgttaatga tgattttggt ccgtgttgtt gagtttgaaa       420
     tgaaaacacc taaagatatt tctgaaacta aatccaagtg tagaaatgtg caaaaatgtt       480
     ttgtactgat aattatatgt gggtactggt tttaggctga ttgtgcagtt cttattgttg       540
     ctgctggtac tggtgaattc gaagctggta tttccaaaaa tggccagacc cgtgaacatg       600
     ctttacttgc cttcaccctt ggtgt                                             625
//