ID KM214783; SV 1; linear; genomic DNA; STD; VRT; 640 BP. XX AC KM214783; XX DT 28-JAN-2015 (Rel. 123, Created) DT 28-MAR-2016 (Rel. 128, Last updated, Version 5) XX DE Garra barreimiae isolate Ex91F8 cytochrome oxidase subunit I (COI) gene, DE partial cds; mitochondrial. XX KW . XX OS Garra barreimiae OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; OC Cyprinidae; Garra. OG Mitochondrion XX RN [1] RP 1-640 RA Hamidan N.A., Geiger M.F., Freyhof J.; RT "Garra jordanica, a new species from the Dead Sea basin with remarks on the RT relationship of G. ghorensis, G. tibanica and G. rufa (Teleostei: RT Cyprinidae)"; RL Ichthyol. Explor. Freshw. 25(3):223-236(2014). XX RN [2] RP 1-640 RA Behrens-Chapuis S., Herder F., Esmaeili H.R., Freyhof J., Hamidan N.A., RA Ozulug M., Sanda R., Geiger M.F.; RT "Adding nuclear rhodopsin data where mitochondrial COI indicates RT discrepancies - can this marker help to explain conflicts in cyprinids?"; RL DNA Barcodes (Berlin) 3:187-199(2015). XX RN [3] RP 1-640 RA Geiger M.F., Freyhof J., Herder F.; RT ; RL Submitted (12-JUL-2014) to the INSDC. RL Ichthyology, ZFMK, Adenauerallee 160, Bonn, NRW 53113, Germany XX DR MD5; a045a00d01d49ddc7721f8340362564a. XX FH Key Location/Qualifiers FH FT source 1..640 FT /organism="Garra barreimiae" FT /organelle="mitochondrion" FT /isolate="Ex91F8" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: VF2_t1, fwd_seq: FT tgtaaaacgacggccagtcaaccaaccacaaagacattggcac, rev_name: FT FR1d_t1, rev_seq: FT caggaaacagctatgacacctcagggtgtccgaaraaycaraa" FT /db_xref="taxon:472393" FT gene <1..>640 FT /gene="COI" FT CDS <1..>640 FT /codon_start=2 FT /transl_table=2 FT /gene="COI" FT /product="cytochrome oxidase subunit I" FT /db_xref="GOA:A0A0B4PJA7" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0B4PJA7" FT /protein_id="AIQ84478.1" FT /translation="FGAWAGMVGTALSLLIRAELSQPGSXLGDDQIYNVIVTAHAFVMI FT FFMVMPILIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSGVEAGXGTG FT XTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTTINMKPPXISQYQTPLF FT VWSVLVTAVLLLLSLPVLAAGITMLLTXRNLNTTFFDPAGGGDPILYQHL" XX SQ Sequence 640 BP; 163 A; 166 C; 124 G; 179 T; 8 other; attcggtgct tgagctggta tagtaggaac tgccctaagc ctccttatcc gggccgagct 60 aagccagccc gggtcgnttt taggcgatga ccaaatctac aacgttatcg ttackgctca 120 cgcttttgta ataattttct ttatagttat acccatcctg atcgggggat ttgggaattg 180 acttgtaccg ctgataattg gggccccgga catagcattc ccgcgaataa ataatataag 240 cttctgacta ctacccccat cgtttctatt attattagcc tcatctggkg tagaagcsgg 300 agntggaacc gggngaacag tttacccacc tcttgcaggc aaccttgccc atgctggggc 360 gtcagtagac ttaacaattt tctcactaca tctggcaggg gtatcgtcaa ttctaggagc 420 cattaatttt attaccacaa ccattaacat aaaaccccca nccatctccc aatatcaaac 480 accactcttc gtgtggtctg tgcttgtaac cgccgtacta cttctattgt cattgccagt 540 actagctgcc ggaatcacaa tgcttctaac anatcgaaat cttaacacca cattttttga 600 cccggcagga ggaggagacc caattcttta tcaacaccta 640 //