ID KM214722; SV 1; linear; genomic DNA; STD; VRT; 562 BP. XX AC KM214722; XX DT 28-JAN-2015 (Rel. 123, Created) DT 28-MAR-2016 (Rel. 128, Last updated, Version 5) XX DE Garra ghorensis isolate Ex91G12 cytochrome oxidase subunit I (COI) gene, DE partial cds; mitochondrial. XX KW . XX OS Garra ghorensis OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; OC Cyprinidae; Garra. OG Mitochondrion XX RN [1] RP 1-562 RA Hamidan N.A., Geiger M.F., Freyhof J.; RT "Garra jordanica, a new species from the Dead Sea basin with remarks on the RT relationship of G. ghorensis, G. tibanica and G. rufa (Teleostei: RT Cyprinidae)"; RL Ichthyol. Explor. Freshw. 25(3):223-236(2014). XX RN [2] RP 1-562 RA Geiger M.F., Freyhof J., Herder F.; RT ; RL Submitted (12-JUL-2014) to the INSDC. RL Ichthyology, ZFMK, Adenauerallee 160, Bonn, NRW 53113, Germany XX DR MD5; bdd5c93b4c2f2f600ad1f7e22ec02746. XX FH Key Location/Qualifiers FH FT source 1..562 FT /organism="Garra ghorensis" FT /organelle="mitochondrion" FT /isolate="Ex91G12" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: VF2_t1, fwd_seq: FT tgtaaaacgacggccagtcaaccaaccacaaagacattggcac, rev_name: FT FR1d_t1, rev_seq: FT caggaaacagctatgacacctcagggtgtccgaaraaycaraa" FT /db_xref="taxon:1483022" FT gene <1..>562 FT /gene="COI" FT CDS <1..>562 FT /codon_start=2 FT /transl_table=2 FT /gene="COI" FT /product="cytochrome oxidase subunit I" FT /db_xref="GOA:A0A0B4PJV9" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A0B4PJV9" FT /protein_id="AIQ84417.1" FT /translation="LGDDQIYNVIVTAHAFVMIFFMVMPILIGGFGNWLVPLMIGAPDM FT AFPRMNNMSFWLLPPSFLLLLASSGVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLH FT LAGVSSILGAINFITTTINMKPPAISQYQTPLFVWSVLVTAVLLLLSLPVLAAGITMLL FT TDRNLNTTFFDPAGGGDPILYQHL" XX SQ Sequence 562 BP; 157 A; 142 C; 98 G; 165 T; 0 other; tttaggtgat gaccaaatct acaacgtcat cgttactgct cacgcttttg taataatttt 60 ctttatagtt atacccattc tgatcggggg gtttggaaat tgacttgtac cactaataat 120 tggagcccca gacatggcat tcccacgaat aaataatata agcttctgac tattaccccc 180 gtcattttta ttattactgg cctcatctgg cgtagaagcc ggagccggaa cgggatgaac 240 agtttatcca ccccttgcag gtaaccttgc ccatgcagga gcgtcagtag acttaacaat 300 tttctcactg catctagcag gagtatcatc aattctaggg gctatcaatt ttattaccac 360 aaccattaat ataaaacccc cagccatctc ccaatatcaa acaccactat tcgtgtggtc 420 tgtacttgta accgccgtac tacttctatt atcactgccg gtgctagctg ctggaattac 480 aatgcttcta acagatcgaa accttaacac cacatttttt gacccggcag gaggaggaga 540 cccaattctt tatcaacacc ta 562 //