ID KM214688; SV 1; linear; genomic DNA; STD; VRT; 652 BP. XX AC KM214688; XX DT 28-JAN-2015 (Rel. 123, Created) DT 28-MAR-2016 (Rel. 128, Last updated, Version 5) XX DE Garra ghorensis isolate Ex91H5 cytochrome oxidase subunit I (COI) gene, DE partial cds; mitochondrial. XX KW . XX OS Garra ghorensis OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; OC Cyprinidae; Garra. OG Mitochondrion XX RN [1] RP 1-652 RA Hamidan N.A., Geiger M.F., Freyhof J.; RT "Garra jordanica, a new species from the Dead Sea basin with remarks on the RT relationship of G. ghorensis, G. tibanica and G. rufa (Teleostei: RT Cyprinidae)"; RL Ichthyol. Explor. Freshw. 25(3):223-236(2014). XX RN [2] RP 1-652 RA Behrens-Chapuis S., Herder F., Esmaeili H.R., Freyhof J., Hamidan N.A., RA Ozulug M., Sanda R., Geiger M.F.; RT "Adding nuclear rhodopsin data where mitochondrial COI indicates RT discrepancies - can this marker help to explain conflicts in cyprinids?"; RL DNA Barcodes (Berlin) 3:187-199(2015). XX RN [3] RP 1-652 RA Geiger M.F., Freyhof J., Herder F.; RT ; RL Submitted (12-JUL-2014) to the INSDC. RL Ichthyology, ZFMK, Adenauerallee 160, Bonn, NRW 53113, Germany XX DR MD5; b686df16a3efe7bdc2a94840d67cb0a3. XX FH Key Location/Qualifiers FH FT source 1..652 FT /organism="Garra ghorensis" FT /organelle="mitochondrion" FT /isolate="Ex91H5" FT /mol_type="genomic DNA" FT /PCR_primers="fwd_name: VF2_t1, fwd_seq: FT tgtaaaacgacggccagtcaaccaaccacaaagacattggcac, rev_name: FT FR1d_t1, rev_seq: FT caggaaacagctatgacacctcagggtgtccgaaraaycaraa" FT /db_xref="taxon:1483022" FT gene <1..>652 FT /gene="COI" FT CDS <1..>652 FT /codon_start=2 FT /transl_table=2 FT /gene="COI" FT /product="cytochrome oxidase subunit I" FT /db_xref="GOA:X5EYF5" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:X5EYF5" FT /protein_id="AIQ84383.1" FT /translation="LYLVFGAWAGMVGTALSLLIRAELSQPGSLLGDDQIYNVIVTAHA FT FVMIFFMVMPILIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSGVEAG FT AGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTTINMKPPAISQYQ FT TPLFVWSVLVTAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHL" XX SQ Sequence 652 BP; 175 A; 165 C; 119 G; 193 T; 0 other; cctttatctt gtatttggtg cttgagctgg tatagtagga actgccctaa gcctccttat 60 ccgagctgaa ctaagccagc ctggatcgct tttaggtgat gaccaaatct acaacgtcat 120 cgttactgct cacgcttttg taataatttt ctttatagtt atacccattc tgatcggggg 180 gtttggaaat tgacttgtac cactaataat tggagcccca gacatggcat tcccacgaat 240 aaataatata agcttctgac tattaccccc gtcattttta ttattactgg cctcatctgg 300 cgtagaagcc ggagccggaa cgggatgaac agtttatcca ccccttgcag gtaaccttgc 360 ccatgcagga gcgtcagtag acttaacaat tttctcactg catctagcag gagtatcatc 420 aattctaggg gctatcaatt ttattaccac aaccattaat ataaaacccc cagccatctc 480 ccaatatcaa acaccactat tcgtgtggtc tgtacttgta accgccgtac tacttctatt 540 atcactgccg gtgctagctg ctggaattac aatgcttcta acagatcgaa accttaacac 600 cacatttttt gacccggcag gaggaggaga cccaattctt tatcaacacc ta 652 //