ID KJ472611; SV 1; linear; genomic DNA; STD; INV; 378 BP. XX AC KJ472611; XX DT 02-APR-2015 (Rel. 124, Created) DT 02-APR-2015 (Rel. 124, Last updated, Version 1) XX DE Pseudophanerotoma sp. RK115 Elongation factor EF1A gene, partial cds. XX KW . XX OS Pseudophanerotoma sp. RK115 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Hymenoptera; Apocrita; Parasitoida; Ichneumonoidea; OC Braconidae; Cheloninae; Pseudophanerotoma; unclassified Pseudophanerotoma. XX RN [1] RP 1-378 RA Kittel R.N., Austin A.D.; RT "Phylogenetics and biogeography of chelonine parasitoid wasps (Hymenoptera: RT Braconidae) based on a fossil calibrated multigene analysis"; RL Unpublished. XX RN [2] RP 1-378 RA Kittel R.N., Austin A.D.; RT ; RL Submitted (19-FEB-2014) to the INSDC. RL The University of Adelaide, School of Earth and Environmental Sciences, RL North Terrace, Adelaide, SA 5005, Australia XX DR MD5; e3ddbc0b2cbcb7938488ee0af5216cdb. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..378 FT /organism="Pseudophanerotoma sp. RK115" FT /mol_type="genomic DNA" FT /country="Guatemala" FT /specimen_voucher="RK115" FT /db_xref="taxon:1590262" FT mRNA <1..>378 FT /product="Elongation factor EF1A" FT CDS <1..>378 FT /codon_start=1 FT /product="Elongation factor EF1A" FT /EC_number="3.6.5.3" FT /note="Elongation factor EF1A F2 copy" FT /db_xref="GOA:A0A0D3Q1S7" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A0A0D3Q1S7" FT /protein_id="AJB28622.1" FT /translation="GITIDIALWKFETFKYYVTIIDAPGHRDFIKNMITGTSQADCAVL FT IVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSETRFEEIKKE FT VSSYIKKIGYTPAAVAFVPISG" XX SQ Sequence 378 BP; 115 A; 78 C; 75 G; 110 T; 0 other; ggtattacca tcgatattgc tttatggaaa ttcgaaacct ttaagtacta tgtaaccatc 60 attgatgctc ctggacacag agatttcatc aaaaacatga ttacgggaac ctcacaggcc 120 gattgtgctg tgttaatcgt agctgccggt actggtgaat ttgaagctgg tatttcaaag 180 aacggacaaa cccgtgaaca cgcccttctt gctttcactc ttggtgttaa gcagctaatc 240 gttggtgtta ataagatgga ctctactgaa ccaccatatt ctgaaactcg atttgaagaa 300 attaaaaaag aagtatcctc atacattaag aagatcggtt atactccagc tgcagttgca 360 ttcgtaccaa tctcagga 378 //