ID KF935396; SV 1; linear; genomic DNA; STD; INV; 328 BP. XX AC KF935396; XX DT 27-JUL-2014 (Rel. 121, Created) DT 27-JUL-2014 (Rel. 121, Last updated, Version 1) XX DE Baseodiscus unicolor isolate SK68 histone H3 gene, partial cds. XX KW . XX OS Baseodiscus unicolor OC Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Nemertea; Pilidiophora; OC Heteronemertea; Baseodiscidae; Baseodiscus. XX RN [1] RP 1-328 RA Kvist S., Laumer C.E., Junoy J., Giribet G.; RT "New insights into the phylogeny, systematics and DNA barcoding of RT Nemertea"; RL Invertebr. Syst. 28:287-308(2014). XX RN [2] RP 1-328 RA Kvist S., Laumer C., Junoy J.J., Giribet G.; RT ; RL Submitted (04-DEC-2013) to the INSDC. RL Department of Organismic and Evolutionary Biology, Museum of Comparative RL Zoology, Harvard University, 26 Oxford Street, Cambridge, MA 02138, USA XX DR MD5; fa9bde772e55b31ac858408dda2ed236. DR EuropePMC; PMC6561998; 31210741. XX CC ##Assembly-Data-START## CC Assembly Method :: Sequencher v. 5.1 CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..328 FT /organism="Baseodiscus unicolor" FT /isolate="SK68" FT /mol_type="genomic DNA" FT /country="Panama" FT /specimen_voucher="MCZ:IZ:135323" FT /collected_by="G. Giribet" FT /collection_date="Mar-2011" FT /db_xref="taxon:547255" FT mRNA <1..>328 FT /product="histone H3" FT CDS <1..>328 FT /codon_start=2 FT /product="histone H3" FT /db_xref="GOA:A0A075QN78" FT /db_xref="InterPro:IPR000164" FT /db_xref="InterPro:IPR007125" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:A0A075QN78" FT /protein_id="AIG20094.1" FT /translation="RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIR FT RYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCA FT IHAKR" XX SQ Sequence 328 BP; 81 A; 102 C; 93 G; 52 T; 0 other; tagaaagtcg acgggtggga aagccccgag gaagcagctg gccaccaaag ccgccagaaa 60 gagtgcaccg gccaccggtg gagtgaagaa gcctcatcga tacaggcccg gcacggtcgc 120 cctccgagag atccgtcgtt accagaagag tacggagctg ttgatcagga aattgccgtt 180 ccagcgtctc gtcagagaaa tcgcccagga cttcaagacg gatctccgct tccagagttc 240 cgccgtcatg gccctgcaag aagccagcga ggcttacctc gtcggactct tcgaggatac 300 caacctctgc gccatccacg ccaaacgt 328 //