ID KF768813; SV 1; linear; genomic DNA; STD; INV; 378 BP. XX AC KF768813; XX DT 11-FEB-2014 (Rel. 119, Created) DT 23-JUN-2016 (Rel. 129, Last updated, Version 3) XX DE Myrsidea textoris voucher Pin-PGR1 cytochrome oxidase subunit I gene, DE partial cds; mitochondrial. XX KW . XX OS Myrsidea textoris OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Paraneoptera; Psocodea; Phthiraptera; Amblycera; Menoponidae; OC Myrsidea. OG Mitochondrion XX RN [1] RP 1-378 RA Sychra O., Halajian A., Luus-Powell W., Engelbrecht D., Symes C., RA Papousek I.; RT "Amblyceran Chewing Lice (Phthiraptera: Amblycera) from Wild Passerines RT (Passeriformes) in South Africa, with a Note to Their Phylogenetic RT Relationships and with the Description of a New Species in the Genus RT Myrsidea"; RL Afr Entomol 22(3):589-601(2014). XX RN [2] RP 1-378 RA Sychra O., Halajian A., Luus-Powell W., Engelbrecht D., Symes C., RA Papousek I.; RT ; RL Submitted (23-OCT-2013) to the INSDC. RL Department of Biology and Wildlife Diseases, University of Veterinary and RL Pharmaceutical Sciences Brno, Palackeho 1/3, Brno 612 42, Czech Republic XX DR MD5; eb428fafcc1d59792d69ce324ce582d3. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..378 FT /organism="Myrsidea textoris" FT /organelle="mitochondrion" FT /host="Ploceus intermedius" FT /mol_type="genomic DNA" FT /country="South Africa" FT /specimen_voucher="Pin-PGR1" FT /db_xref="taxon:1458148" FT CDS <1..>378 FT /codon_start=1 FT /transl_table=5 FT /product="cytochrome oxidase subunit I" FT /db_xref="GOA:W6A4B7" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:W6A4B7" FT /protein_id="AHI46402.1" FT /translation="EVYILILPAFGIVSHIISQESGKKESFGVIGMIYAMLSIGVLGFI FT VWAHHMFTVGMDIDTRAYFTSATMVIAIPTGVKVFSWLSTLLGSKLTSNPNTLWAVGFV FT FLFTIGGLTGVVLANSSIDIVL" XX SQ Sequence 378 BP; 99 A; 66 C; 79 G; 134 T; 0 other; gaagtttaca ttctaattct gccagctttt ggtattgtat cccatatcat ctctcaagag 60 agaggtaaaa aggagagttt tggggttatt ggaatgattt atgctatact ttctattgga 120 gtattaggat ttattgtatg agctcaccac atgtttacag ttggaataga tattgatacg 180 cgagcctact ttacatctgc aactatagtg attgcaatcc ccacaggagt taaagtgttt 240 agatggcttt ctaccttgct aggaagcaag ctaacctcta accctaacac tctatgggct 300 gttgggtttg tgttcctgtt tactattgga ggtttaacag gtgtagttct agcaaattca 360 tctattgaca ttgtcctc 378 //