ID KF753816; SV 1; linear; genomic DNA; STD; INV; 328 BP. XX AC KF753816; XX DT 04-JUL-2014 (Rel. 121, Created) DT 04-JUL-2014 (Rel. 121, Last updated, Version 1) XX DE Pinkertonius ambiguus cytochrome b gene, partial cds; mitochondrial. XX KW . XX OS Pinkertonius ambiguus OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Multicrustacea; OC Hexanauplia; Copepoda; Calanoida; Pseudocyclopidae; Pinkertonius. OG Mitochondrion XX RN [1] RP 1-328 RA Bradford-Grieve J.M., Boxshall G.A., Blanco-Bercial L.; RT "Revision of basal calanoid copepod families with a description of a new RT species and genus of Pseudocyclopidae"; RL Zool. J. Linn. Soc. 171(3):507-533(2014). XX RN [2] RP 1-328 RA Blanco-Bercial L., Bradford-Grieve J.M., Bucklin A.; RT ; RL Submitted (23-OCT-2013) to the INSDC. RL Marine Sciences, University of Connecticut, 1080 Shennecossett Rd, Groton, RL CT 06340, USA XX DR MD5; 1028b35890eead227a834d36fa93df1a. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..328 FT /organism="Pinkertonius ambiguus" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /lat_lon="44.7 S 173.7 E" FT /specimen_voucher="NIWA:084501" FT /specimen_voucher="UCONN:CMarZ Co449.1.1" FT /collected_by="Janet M. Bradford-Grieve" FT /PCR_primers="fwd_name: UCYTB151F, fwd_seq: FT tgtggrgcnacygtwatyactaa, rev_name: UCYTB270R, rev_seq: FT aanaggaartaycaytcnggytg" FT /db_xref="taxon:1517688" FT CDS <1..>328 FT /codon_start=3 FT /transl_table=5 FT /product="cytochrome b" FT /db_xref="GOA:A0A068L5T0" FT /db_xref="InterPro:IPR005797" FT /db_xref="InterPro:IPR005798" FT /db_xref="InterPro:IPR016174" FT /db_xref="InterPro:IPR027387" FT /db_xref="UniProtKB/TrEMBL:A0A068L5T0" FT /protein_id="AIE39450.1" FT /translation="SSWMWGGFAVDNATLTRFFTLHFILPFGIVGLSGVHLLFLHQTGS FT NNPLGLCSGYDKIAFHPYFSWKDLTGALVLMALTLVVSLFYPWALGDPENFIPANPLVT FT PVHI" XX SQ Sequence 328 BP; 79 A; 64 C; 64 G; 121 T; 0 other; ttagttcatg aatatggggg ggctttgctg ttgataacgc aaccttaaca cgatttttta 60 ctttacattt tattttaccc tttgggattg ttggattgag aggggtgcac ttattatttt 120 tacatcaaac cggctcaaat aaccctctag gtctttgtag aggttatgat aaaattgcct 180 ttcatcctta tttttcttga aaagatttaa caggggcgct tgtgctcata gcactaacac 240 tagtagtgag cctgttttat ccttgggctt taggagaccc tgaaaatttt attcctgcta 300 atcctcttgt gacccctgtg cacatcca 328 //