ID KF682722; SV 1; linear; genomic DNA; STD; INV; 378 BP. XX AC KF682722; XX DT 27-JAN-2014 (Rel. 119, Created) DT 15-MAY-2014 (Rel. 120, Last updated, Version 3) XX DE Hexapanopeus sp. n. ULLZ 12526 enolase gene, partial cds. XX KW . XX OS Hexapanopeus sp. n. ULLZ 12526 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Multicrustacea; OC Malacostraca; Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Brachyura; OC Eubrachyura; Xanthoidea; Panopeidae; Hexapanopeus; OC unclassified Hexapanopeus. XX RN [1] RP 1-378 RA Thoma B.P., Guinot D., Felder D.L.; RT "Evolutionary relationships among American mud crabs (Crustacea: Decapoda: RT Brachyura: Xanthoidea) inferred from nuclear and mitochondrial markers, RT with comments on adult morphology"; RL Zool. J. Linn. Soc. 170(1):86-109(2014). XX RN [2] RP 1-378 RA Thoma B.P., Guinot D., Felder D.L.; RT ; RL Submitted (13-SEP-2013) to the INSDC. RL Department of Biology and Laboratory for Crustacean Research, University of RL Louisiana at Lafayette, 300 East St. Mary Blvd., Lafayette, LA 70503, USA XX DR MD5; d284e07ced507fe44763335f6a194eb8. XX CC ##Assembly-Data-START## CC Assembly Method :: Sequencher v. 5.10 CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..378 FT /organism="Hexapanopeus sp. n. ULLZ 12526" FT /mol_type="genomic DNA" FT /country="Belize" FT /isolation_source="South Water Cay" FT /specimen_voucher="ULLZ 12526" FT /identified_by="Darryl L. Felder" FT /db_xref="taxon:1450300" FT mRNA <1..>378 FT /product="enolase" FT CDS <1..>378 FT /codon_start=1 FT /product="enolase" FT /db_xref="GOA:W5RZP3" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:W5RZP3" FT /protein_id="AHG95554.1" FT /translation="MILPTGASSFTEAMRMGSEVYHHLKAVIKARFGLDATAVGDEGGF FT APNILNNKDALDLIQEAIKKAGYTGKIEIGMDVAASEFYKGNNVYDLDFKTANNDGSQK FT ISGDQLRDMYMEFCKDFPIVSI" XX SQ Sequence 378 BP; 102 A; 77 C; 94 G; 105 T; 0 other; atgatcctgc ccactggtgc aagtagcttt actgaagcaa tgcgcatggg cagtgaggta 60 taccatcact tgaaggctgt cattaaggca cgctttggcc ttgatgctac tgctgtgggt 120 gatgaaggag gctttgcacc caacattctt aacaacaagg atgctctgga ccttatccaa 180 gaggccatta agaaggctgg ttacacaggc aagattgaaa ttggaatgga tgtggctgca 240 tctgaattct acaagggcaa taatgtctat gaccttgact tcaagactgc taataatgat 300 ggttctcaga agatctctgg tgaccagctc agggacatgt atatggaatt ctgtaaggac 360 ttccccattg tttctatt 378 //