ID KF682634; SV 1; linear; genomic DNA; STD; INV; 378 BP. XX AC KF682634; XX DT 27-JAN-2014 (Rel. 119, Created) DT 15-MAY-2014 (Rel. 120, Last updated, Version 3) XX DE Micropanope pusilla voucher ULLZ 6776 enolase gene, partial cds. XX KW . XX OS Micropanope pusilla OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Multicrustacea; OC Malacostraca; Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Brachyura; OC Eubrachyura; Xanthoidea; Xanthidae; Micropanope. XX RN [1] RP 1-378 RA Thoma B.P., Guinot D., Felder D.L.; RT "Evolutionary relationships among American mud crabs (Crustacea: Decapoda: RT Brachyura: Xanthoidea) inferred from nuclear and mitochondrial markers, RT with comments on adult morphology"; RL Zool. J. Linn. Soc. 170(1):86-109(2014). XX RN [2] RP 1-378 RA Thoma B.P., Guinot D., Felder D.L.; RT ; RL Submitted (13-SEP-2013) to the INSDC. RL Department of Biology and Laboratory for Crustacean Research, University of RL Louisiana at Lafayette, 300 East St. Mary Blvd., Lafayette, LA 70503, USA XX DR MD5; a3a4c392356dda061dfb989d1047edb4. XX CC ##Assembly-Data-START## CC Assembly Method :: Sequencher v. 5.10 CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..378 FT /organism="Micropanope pusilla" FT /mol_type="genomic DNA" FT /country="Mexico" FT /lat_lon="22.23 N 90.69 W" FT /isolation_source="Gulf of Mexico, off Campeche" FT /specimen_voucher="ULLZ 6776" FT /identified_by="Darryl L. Felder" FT /db_xref="taxon:689419" FT mRNA <1..>378 FT /product="enolase" FT CDS <1..>378 FT /codon_start=1 FT /product="enolase" FT /db_xref="GOA:W5RYD5" FT /db_xref="InterPro:IPR000941" FT /db_xref="InterPro:IPR020810" FT /db_xref="InterPro:IPR036849" FT /db_xref="UniProtKB/TrEMBL:W5RYD5" FT /protein_id="AHG95466.1" FT /translation="MILPTGASSFTEAMRMGSEVYHHLKAVIKARFGLDATAVGDEGGF FT APNILNNKDALDLIQEAIQKAGYTGKIEIGMDVAASEFYKGNNVYDLDFKTANNDGSQK FT ISGDQLRDLYMEFCKDFPIVSI" XX SQ Sequence 378 BP; 101 A; 86 C; 90 G; 101 T; 0 other; atgatcctgc ccactggtgc aagtagcttt actgaagcca tgcgcatggg tagtgaggtc 60 taccatcact tgaaggctgt cattaaggca cgctttggcc tggatgctac tgctgtgggt 120 gatgaaggag gctttgcacc caacattctt aacaacaagg atgctctcga ccttatccaa 180 gaggccatcc aaaaggctgg ttacacaggc aagattgaaa ttggaatgga tgtggctgca 240 tctgaattct acaaaggcaa caatgtttat gaccttgact tcaagactgc taataatgat 300 ggttctcaaa agatctctgg tgaccagctc agggacctct atatggaatt ctgcaaggac 360 ttccccatcg tttccatt 378 //