ID KF054368; SV 1; linear; genomic DNA; STD; INV; 204 BP. XX AC KF054368; XX DT 03-NOV-2013 (Rel. 118, Created) DT 03-NOV-2013 (Rel. 118, Last updated, Version 1) XX DE Bathypathes patula isolate 41-1A cytochrome c oxidase subunit I (cox1) DE gene, partial cds; mitochondrial. XX KW . XX OS Bathypathes patula OC Eukaryota; Metazoa; Cnidaria; Anthozoa; Hexacorallia; Antipatharia; OC Schizopathidae; Bathypathes. OG Mitochondrion XX RN [1] RP 1-204 RA Brugler M.R., Opresko D.M., France S.C.; RT "The evolutionary history of the order Antipatharia (Cnidaria: Anthozoa: RT Hexacorallia) as inferred from mitochondrial and nuclear DNA: implications RT for black coral taxonomy and systematics"; RL Zool. J. Linn. Soc. 169(2):312-361(2013). XX RN [2] RP 1-204 RA Brugler M.R., France S.C.; RT ; RL Submitted (17-MAY-2013) to the INSDC. RL Department of Biology, University of Louisiana at Lafayette, P.O. Box RL 42451, Lafayette, LA 70504, USA XX DR MD5; 6c0abb19fbb187e8f91794264d667c6a. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..204 FT /organism="Bathypathes patula" FT /organelle="mitochondrion" FT /isolate="41-1A" FT /mol_type="genomic DNA" FT /db_xref="taxon:1350341" FT gene <1..>204 FT /gene="cox1" FT CDS <1..>204 FT /codon_start=1 FT /transl_table=4 FT /gene="cox1" FT /product="cytochrome c oxidase subunit I" FT /db_xref="GOA:U5KB48" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:U5KB48" FT /protein_id="AGQ18126.1" FT /translation="GMVGTALSMLIRLELSAPGTMLGDDHLYNVIVTAHALIMIFFLVM FT PVMIGGFGNWLVPLYIGAPDMAF" XX SQ Sequence 204 BP; 47 A; 35 C; 50 G; 72 T; 0 other; ggtatggtag gtacagcttt aagtatgttg attagattag aactatctgc tcctggcact 60 atgttagggg acgaccatct ttataatgta atagttacag cgcatgccct tattatgatt 120 ttcttcttag tcatgccagt tatgataggg ggatttggga attggcttgt cccactatat 180 atcggtgcgc cggatatggc tttc 204 //