ID JX560756; SV 1; linear; genomic DNA; STD; INV; 217 BP. XX AC JX560756; XX DT 01-SEP-2013 (Rel. 118, Created) DT 01-SEP-2013 (Rel. 118, Last updated, Version 1) XX DE Bathypathes patula isolate 41-101-B1 cytochrome oxidase subunit 1 (cox1) DE gene, partial cds; mitochondrial. XX KW . XX OS Bathypathes patula OC Eukaryota; Metazoa; Cnidaria; Anthozoa; Hexacorallia; Antipatharia; OC Schizopathidae; Bathypathes. OG Mitochondrion XX RN [1] RP 1-217 RA MacIsaac K.G., Best M., Kenchington E.L.R., Anstey L.J., Jordan T.J.M., RA Brugler M.R.; RT "Telopathes magna gen. nov., spec. nov. (Cnidaria: Anthozoa: Antipatharia: RT Schizopathidae) from deep-waters off Atlantic Canada and the first RT molecular phylogeny of the deep-sea family Schizopathidae"; RL Unpublished. XX RN [2] RP 1-217 RA Brugler M.R.; RT ; RL Submitted (29-AUG-2012) to the INSDC. RL Sackler Institute for Comparative Genomics, Division of Invertebrate RL Zoology, American Museum of Natural History, Central Park West at 79th RL Street, New York, NY 10024, USA XX DR MD5; e00d257a24f457ce305087eb72020ddc. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..217 FT /organism="Bathypathes patula" FT /organelle="mitochondrion" FT /isolate="41-101-B1" FT /mol_type="genomic DNA" FT /db_xref="taxon:1350341" FT gene <1..>217 FT /gene="cox1" FT CDS <1..>217 FT /codon_start=2 FT /transl_table=4 FT /gene="cox1" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:T1RYI3" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:T1RYI3" FT /protein_id="AGQ03885.1" FT /translation="GIGSGMVGTALSMLIRLELSAPGTMLGDDHLYNVIVTAHALIMIF FT FLVMPVMIGGFGNWLVPLYIGAPDMAF" XX SQ Sequence 217 BP; 50 A; 36 C; 55 G; 76 T; 0 other; tggaataggg tctggtatgg taggtacagc tttaagtatg ttgattagat tagaactatc 60 tgctcctggc actatgttag gggacgacca tctttataat gtaatagtta cagcgcatgc 120 ccttattatg attttcttct tagtcatgcc agttatgata gggggatttg ggaattggct 180 tgtcccacta tatatcggtg cgccggatat ggctttc 217 //