ID JN936875; SV 1; linear; genomic DNA; STD; INV; 612 BP. XX AC JN936875; XX DT 10-SEP-2012 (Rel. 114, Created) DT 10-SEP-2012 (Rel. 114, Last updated, Version 1) XX DE Proctophyllodes valchukae voucher AMUMD016 cytochrome c oxidase subunit I DE (COI) gene, partial cds; mitochondrial. XX KW . XX OS Proctophyllodes valchukae OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Chelicerata; Arachnida; Acari; OC Acariformes; Sarcoptiformes; Astigmata; Psoroptidia; Analgoidea; OC Proctophyllodidae; Proctophyllodinae; Proctophyllodes. OG Mitochondrion XX RN [1] RP 1-612 RA Mironov S.V., Dabert J., Dabert M.; RT "A new feather mite species of the genus Proctophyllodes Robin, 1877 RT (Astigmata: Proctophyllodidae) from the Long-tailed Tit Aegithalos caudatus RT (Passeriformes: Aegithalidae) morphological description with DNA barcode RT data"; RL Zootaxa 3253:54-61(2012). XX RN [2] RP 1-612 RA Mironov S.V., Dabert J., Dabert M.; RT ; RL Submitted (25-OCT-2011) to the INSDC. RL Molecular Biology Techniques Laboratory, Faculty of Biology, Adam RL Mickiewicz University in Poznan, Umultowska 89, Poznan 61-614, Poland XX DR MD5; 88d0093ba1da34968ea8e797ad37e663. XX FH Key Location/Qualifiers FH FT source 1..612 FT /organism="Proctophyllodes valchukae" FT /organelle="mitochondrion" FT /host="Aegithalos caudatus (long-tailed tit)" FT /mol_type="genomic DNA" FT /specimen_voucher="AMUMD016" FT /identified_by="S. V. Mironov" FT /PCR_primers="fwd_name: bcdF05, fwd_seq: FT ttttctachaaycataaagatattgc, rev_name: bcdR04, rev_seq: FT tataaacytcdggatgnccaaaaaa" FT /db_xref="taxon:1229481" FT gene <1..>612 FT /gene="COI" FT CDS <1..>612 FT /codon_start=2 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome c oxidase subunit I" FT /db_xref="GOA:J7LMY3" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:J7LMY3" FT /protein_id="AFR24091.1" FT /translation="LIRFELSQPGDFMMDFDYYNSVVTAHAFIMIFFMVMPIMMGGFGN FT LLVPMMIGATDMAYPRLNNMSFWLLPPSLSLLISSAVVGAGVGTGWTVYPPLSNGVFHS FT GPAVDFGILSLHIAGVSSILGAINFIVTIFNMKVEGMLWSNVPLFVWSVLITSFLLAFS FT LPVLAAALTMLLTDRNFNSTFFDPVGGGDPILYQHLFWFFG" XX SQ Sequence 612 BP; 132 A; 98 C; 112 G; 270 T; 0 other; tttaattcgt tttgaattat ctcaacccgg ggattttata atagattttg attactataa 60 ttctgttgtt acagctcatg cttttattat aatttttttt atagttatac caatcatgat 120 aggaggcttt gggaatcttt tagttcctat gatgatcggg gcgactgata tggcttatcc 180 tcgtttgaac aatataagtt tttgattact tcccccttct ttatctttat taattagatc 240 agctgtggta ggagctggag tgggcacagg ttgaacagtg taccctcctc tttctaatgg 300 tgtttttcat tccggtcctg cagtagattt tgggattctt agcttacata ttgctggtgt 360 ttcttctatt cttggggcca ttaattttat tgttactatt tttaacataa aagttgaggg 420 tatattatgg tcaaatgttc cattatttgt ttggtcagtt ttaattacct cttttttact 480 tgctttttct ttgcctgttt tagccgctgc tttaactatg cttcttacag atcgaaactt 540 taattcaact ttttttgacc ctgtaggagg tggtgatccc attttgtatc aacacttgtt 600 ttggtttttt gg 612 //