ID JN638820; SV 1; linear; genomic DNA; STD; INV; 379 BP. XX AC JN638820; XX DT 01-OCT-2012 (Rel. 114, Created) DT 01-OCT-2012 (Rel. 114, Last updated, Version 1) XX DE Myrsidea ochrolaemi voucher Mysp.Auoch.5.1.2006.16 cytochrome oxidase DE subunit I (COI) gene, partial cds; mitochondrial. XX KW . XX OS Myrsidea ochrolaemi OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Paraneoptera; Psocodea; Phthiraptera; Amblycera; Menoponidae; OC Myrsidea. OG Mitochondrion XX RN [1] RP 1-379 RA Valim M.P., Price R.D., Johnson K.P.; RT "New host records and descriptions of five new species of Myrsidea RT Waterson, 1915 (Phthiraptera: Menoponidae) from passerines (Aves: RT Passeriformes)"; RL Zootaxa 0:0(2012). XX RN [2] RP 1-379 RA Johnson K.P.; RT ; RL Submitted (31-AUG-2011) to the INSDC. RL Illinois Natural History Survey, University of Illinois, 1816 South Oak RL Street, Champaign, IL 61820, USA XX DR MD5; 9dc97e9c1c458aa470d8fe65286e6bd2. XX FH Key Location/Qualifiers FH FT source 1..379 FT /organism="Myrsidea ochrolaemi" FT /organelle="mitochondrion" FT /host="Automolus ochrolaemus" FT /mol_type="genomic DNA" FT /specimen_voucher="Mysp.Auoch.5.1.2006.16" FT /db_xref="taxon:1154670" FT gene <1..>379 FT /gene="COI" FT CDS <1..>379 FT /codon_start=2 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit I" FT /db_xref="GOA:J9PY75" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:J9PY75" FT /protein_id="AFC56763.1" FT /translation="EVYILILPAFGMISHIITQEAGKKESFGVISMIYAMLSIGILGFI FT VWAHHMFTVGMDIDTRAYFTSATMVIAIPTGVKVFSWMSTILGGKLTWNPNVLWSVGFV FT FLFTIGGLTGVILANSSIDIIL" XX SQ Sequence 379 BP; 110 A; 54 C; 73 G; 142 T; 0 other; agaagtctat attttaattc tacctgcctt tggtatgatt tctcacatta ttacccaaga 60 agctgggaag aaggaaaggt ttggtgttat tagtataatc tatgcaatgc tatctattgg 120 gattttaggg ttcattgtat gagctcatca tatattcact gtgggaatag atattgatac 180 acgggcatat tttacttctg caacaatagt aattgctatc ccaactggag ttaaggtatt 240 tagatgaata tctactattt taggtggaaa gttaacatga aaccccaatg ttttatggtc 300 agttggcttt gtgtttctat ttactattgg aggattaaca ggagttattc ttgctaactc 360 atcaattgac atcatttta 379 //