ID JN377403; SV 1; linear; genomic DNA; STD; VRT; 658 BP. XX AC JN377403; XX DT 11-JUN-2012 (Rel. 113, Created) DT 26-DEC-2016 (Rel. 131, Last updated, Version 2) XX DE Nototriton nelsoni cytochrome oxidase subunit 1 gene, partial cds; DE mitochondrial. XX KW . XX OS Nototriton nelsoni OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; OC Batrachia; Caudata; Salamandroidea; Plethodontidae; Hemidactyliinae; OC Nototriton. OG Mitochondrion XX RN [1] RP 1-658 RA Townsend J.H., Medina-Flores M., Murillo J.L., Austin J.D.; RT "Cryptic diversity in Chortis Highland moss salamanders (Caudata: RT Plethodontidae: Nototriton) revealed using mtDNA barcodes and RT phylogenetics, with the description of a new species from eastern RT Honduras"; RL System. Biodivers. 9(3):275-287(2011). XX RN [2] RP 1-658 RA Townsend J.H.; RT ; RL Submitted (20-JUL-2011) to the INSDC. RL Wildlife Ecology & Conservation, University of Florida, Molecular Ecology RL Lab, Bldg 63, Mowry Road, Gainesville, FL 32608, USA XX DR MD5; 353d06fbd0d8d5828c973e64b8c9b0ea. XX FH Key Location/Qualifiers FH FT source 1..658 FT /organism="Nototriton nelsoni" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /country="Honduras:Atlantida, La Liberacion" FT /specimen_voucher="USNM:578300" FT /db_xref="taxon:1129740" FT CDS <1..>658 FT /codon_start=2 FT /transl_table=2 FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:I3XMX7" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:I3XMX7" FT /protein_id="AFL65160.1" FT /translation="TLYLVFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVIVTAH FT AFVMIFFMVMPIMIGGFGNWLLPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSGVEA FT GAGTGWTVYPPLAGNMAHAGASVDLTIFSLHLAGVSSILGAINFITTSINMKPPSMSQY FT QTPLFVWSVLITAILLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPVLYQHLF" XX SQ Sequence 658 BP; 170 A; 190 C; 118 G; 180 T; 0 other; caccctttat ctagtatttg gtgcctgagc cggcatagtg ggcacagccc tcagcctctt 60 aatccgagca gagcttggac agccaggaac cctcctgggg gacgaccaaa tctataatgt 120 tatcgttact gcccatgcct tcgttataat cttctttata gttataccga ttatgatcgg 180 aggattcgga aactggctac tcccactaat aattggcgca ccagacatgg ccttcccccg 240 cataaataat ataagctttt ggctcctccc accctccttc cttcttctac tagcatcctc 300 cggagtagaa gccggtgccg gaaccggctg aacagtctat ccccccttgg ccggaaacat 360 ggcacatgca ggagcctctg tagatttaac aatcttctcc cttcacctgg ccggagtctc 420 ttctatccta ggagcaatta actttattac aacctcaatc aacataaaac caccatcaat 480 gtcacaatac cagacaccat tattcgtatg atcagtactt attactgcaa ttttactatt 540 gctgtcttta cctgtattag cagcaggaat caccatgcta ttaaccgacc gaaacctaaa 600 cacaacattt tttgatccgg cagggggtgg cgaccccgta ctataccaac atcttttc 658 //