ID JN377401; SV 1; linear; genomic DNA; STD; VRT; 658 BP. XX AC JN377401; XX DT 11-JUN-2012 (Rel. 113, Created) DT 11-JUN-2012 (Rel. 113, Last updated, Version 1) XX DE Nototriton barbouri voucher UF:JHT2420 cytochrome oxidase subunit 1 gene, DE partial cds; mitochondrial. XX KW . XX OS Nototriton barbouri OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; OC Batrachia; Caudata; Salamandroidea; Plethodontidae; Hemidactyliinae; OC Nototriton. OG Mitochondrion XX RN [1] RP 1-658 RA Townsend J.H., Medina-Flores M., Murillo J.L., Austin J.D.; RT "Cryptic diversity in Chortis Highland moss salamanders (Caudata: RT Plethodontidae: Nototriton) revealed using mtDNA barcodes and RT phylogenetics, with the description of a new species from eastern RT Honduras"; RL System. Biodivers. 9(3):275-287(2011). XX RN [2] RP 1-658 RA Townsend J.H.; RT ; RL Submitted (20-JUL-2011) to the INSDC. RL Wildlife Ecology & Conservation, University of Florida, Molecular Ecology RL Lab, Bldg 63, Mowry Road, Gainesville, FL 32608, USA XX DR MD5; 5c7cb2a192707aab567de36673fd1b82. XX FH Key Location/Qualifiers FH FT source 1..658 FT /organism="Nototriton barbouri" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /country="Honduras:Yoro, Macuzal" FT /specimen_voucher="UF:JHT2420" FT /db_xref="taxon:107975" FT CDS <1..>658 FT /codon_start=2 FT /transl_table=2 FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:I3XMX5" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:I3XMX5" FT /protein_id="AFL65158.1" FT /translation="TLYLVFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAH FT AFVMIFFMVMPIMIGGFGNWLLPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSGVEA FT GAGTGWTVYPPLAGNMAHAGASVDLTIFSLHLAGVSSILGAINFITTSINMKPPSMSQY FT QTPLFVWSVLITAILLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPVLYQHLF" XX SQ Sequence 658 BP; 165 A; 188 C; 117 G; 188 T; 0 other; caccctttac ttagtatttg gtgcctgagc cggcatagtc ggcacagccc tcagcctcct 60 aatccgagca gaacttggac aaccgggcac ccttttaggg gatgaccaga tttataatgt 120 tgttgttact gcccatgcct tcgtcataat cttctttata gttataccaa tcatgatcgg 180 gggattcgga aattggctac tcccactaat aatcggtgcg ccagacatgg ccttccctcg 240 aataaataat ataagctttt gactccttcc cccctccttc cttctcctgc tagcatcctc 300 gggagtagaa gccggtgctg gcaccggctg aacagtctat ccccctttgg ccggaaacat 360 ggcgcatgcc ggagcctctg tagatcttac aatcttctcc ttacacttag ccggagtctc 420 ttccatcctt ggagcaatta actttattac aacctcaatt aacataaaac caccatcaat 480 atcacaatac cagacacccc tatttgtatg atctgtactt atcaccgcaa ttttactact 540 attatcttta cctgtactag cagcaggcat cactatgctc ttaactgacc gaaacctaaa 600 cacaacattt tttgacccgg caggaggtgg ggatccagta ctataccagc atcttttc 658 //