ID HM622364; SV 1; linear; genomic DNA; STD; VRT; 1038 BP. XX AC HM622364; XX DT 02-AUG-2010 (Rel. 105, Created) DT 08-SEP-2010 (Rel. 106, Last updated, Version 2) XX DE Hemidactylus prashadi voucher CES07040 recombination activating protein 1 DE (RAG-1) gene, partial cds. XX KW . XX OS Hemidactylus prashadi OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Lepidosauria; Squamata; Bifurcata; Gekkota; Gekkonidae; Gekkoninae; OC Hemidactylus. XX RN [1] RP 1-1038 RX DOI; 10.1016/j.ympev.2010.06.008. RX PUBMED; 20601015. RA Bansal R., Karanth K.P.; RT "Molecular phylogeny of Hemidactylus geckos (Squamata: Gekkonidae) of the RT Indian subcontinent reveals a unique Indian radiation and an Indian origin RT of Asian house geckos"; RL Mol. Phylogenet. Evol. 57(1):459-465(2010). XX RN [2] RP 1-1038 RA Bansal R., Karanth K.P.; RT ; RL Submitted (30-JUN-2010) to the INSDC. RL Centre for Ecological Science, Indian Institute of Science, C. V. Raman RL Avenue, Bangalore, Karnataka 560012, India XX DR MD5; d55300d768b5e8380379561f72b85530. XX FH Key Location/Qualifiers FH FT source 1..1038 FT /organism="Hemidactylus prashadi" FT /mol_type="genomic DNA" FT /specimen_voucher="CES07040" FT /db_xref="taxon:863657" FT gene <1..>1038 FT /gene="RAG-1" FT mRNA <1..>1038 FT /gene="RAG-1" FT /product="recombination activating protein 1" FT CDS <1..>1038 FT /codon_start=1 FT /gene="RAG-1" FT /product="recombination activating protein 1" FT /db_xref="GOA:E1ACK2" FT /db_xref="InterPro:IPR001841" FT /db_xref="InterPro:IPR013083" FT /db_xref="InterPro:IPR017907" FT /db_xref="InterPro:IPR018957" FT /db_xref="InterPro:IPR019485" FT /db_xref="InterPro:IPR024627" FT /db_xref="InterPro:IPR035714" FT /db_xref="InterPro:IPR036236" FT /db_xref="UniProtKB/TrEMBL:E1ACK2" FT /protein_id="ADK73541.1" FT /translation="KSLPEESHLANNDNMEMAASLDKGNDAMTIMLKEPFHRGQSLNNS FT MQSIDKDAFSVNQREIEAHQVNLQHLCRICGGSFKNDLYKRSHPVHGPVDDEMQALLRK FT KERKATSWPDLLNKVFKIDVRGDMDTIHPTNFCHNCWSVVQRKFSNLPCEVYFPRKGTM FT EWHPHSTSCDVCGTSSHGIKRKKQDPSPQGGKKLRIIAERARRIMYARSQKQVNSKNIM FT KKITNCKKMHLSTKMLTVDYPADFVKSISCQICEHILADPVETTCKHLFCRLCILKCLK FT VIGSYCPSCRYPCFPTDLVDPVRSFLNILNALAVRCPVKNCHEEITLGKYSRHLSSHKE FT KKEKGT" XX SQ Sequence 1038 BP; 351 A; 212 C; 224 G; 251 T; 0 other; aaatcacttc ctgaagagag ccatctggct aacaatgata atatggaaat ggcagcttct 60 ttggacaagg gcaatgatgc aatgactata atgctgaaag agccctttca cagaggacaa 120 agtctgaaca acagcatgca gagtatagat aaagatgcct tttctgtaaa ccaaagagaa 180 attgaagcac accaagtaaa cttgcagcac ctctgtcgca tatgtggtgg ttcatttaaa 240 aatgatcttt ataagagaag ccacccagta catgggccag tggatgatga aatgcaagcc 300 cttctaagaa aaaaggaaag aaaggccact tcttggccag atctacttaa caaggttttt 360 aagattgatg tgagaggaga catggacaca atccatccta ctaatttttg tcacaactgc 420 tggagcgttg tccagaggaa gttcagcaat ctcccatgtg aagtgtattt tccaaggaaa 480 ggcactatgg aatggcatcc ccattcaacc agctgtgatg tttgtggcac ttcctcccat 540 ggaataaaga gaaagaagca agacccaagt ccacaggggg ggaaaaagct caggatcatt 600 gctgaacgtg ctagaaggat aatgtatgca agaagccaaa aacaagtgaa cagcaaaaac 660 atcatgaaaa agattaccaa ttgtaaaaag atgcatctca gtacaaagat gctcacagtt 720 gactatcctg cagattttgt aaaatccata tcttgccaga tctgtgagca tattctggct 780 gacccagtag aaacaacatg caagcactta ttctgtagac tgtgcatcct gaaatgcctc 840 aaagtaatag gaagctattg cccatcctgt cgctatcctt gttttcctac tgatctggtg 900 gaccctgtga gatccttcct gaacatactc aatgctttgg ctgtgaggtg tccagtgaaa 960 aactgtcatg aagagatcac tcttggaaaa tacagccgtc atctttctag ccacaaggag 1020 aaaaaagaga aaggaact 1038 //