ID HM595673; SV 1; linear; genomic DNA; STD; VRT; 272 BP. XX AC HM595673; XX DT 11-OCT-2010 (Rel. 106, Created) DT 11-OCT-2010 (Rel. 106, Last updated, Version 1) XX DE Hemidactylus triedrus voucher CES07007 cytochrome b (cytb) gene, partial DE cds; mitochondrial. XX KW . XX OS Hemidactylus subtriedrus OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Lepidosauria; Squamata; Bifurcata; Gekkota; Gekkonidae; Gekkoninae; OC Hemidactylus. OG Mitochondrion XX RN [1] RC Publication Status: Available-Online prior to print RP 1-272 RX DOI; 10.1016/j.ympev.2010.06.008. RX PUBMED; 20601015. RA Bansal R., Karanth K.P.; RT "Molecular phylogeny of Hemidactylus geckos (Squamata: Gekkonidae) of the RT Indian subcontinent reveals a unique Indian radiation and an Indian origin RT of Asian house geckos"; RL Mol. Phylogenet. Evol. 57(1):459-465(2010). XX RN [2] RP 1-272 RA Bansal R., Karanth K.P.; RT ; RL Submitted (29-JUN-2010) to the INSDC. RL Centre for Ecological Science, Indian Institute of Science, C. V. Raman RL Avenue, Bangalore, Karnataka 560012, India XX DR MD5; 09c1da8c878ebefa15c6cdbe6e16b0e7. XX FH Key Location/Qualifiers FH FT source 1..272 FT /organism="Hemidactylus subtriedrus" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /specimen_voucher="CES07007" FT /db_xref="taxon:913952" FT gene <1..>272 FT /gene="cytb" FT CDS <1..>272 FT /codon_start=1 FT /transl_table=2 FT /gene="cytb" FT /product="cytochrome b" FT /protein_id="ADO17839.1" FT /translation="FGSLLGLCLLTQLGTGLFLAMHFTADTALSFASVAHICRDVQYGW FT LIRNIHANGASMFFICIYLHIGRGLYYGSYLYKETWNTGVVLLLLS" XX SQ Sequence 272 BP; 65 A; 90 C; 48 G; 69 T; 0 other; tttggctcat tacttggcct atgcctgcta acacagctcg gaaccggcct gttcctagca 60 atacacttca ccgccgatac agcactctcc ttcgcctccg tcgcccacat ctgccgagac 120 gtacagtacg gctgactaat ccgcaacatc catgccaacg gagcatcaat attctttatc 180 tgtatctacc tccacattgg ccgcggactg tactacggat cctacttata caaagaaact 240 tgaaacaccg gggtcgtcct actactactt tc 272 //