ID HM595672; SV 1; linear; genomic DNA; STD; VRT; 277 BP. XX AC HM595672; XX DT 11-OCT-2010 (Rel. 106, Created) DT 11-OCT-2010 (Rel. 106, Last updated, Version 1) XX DE Hemidactylus sataraensis voucher CES08010 cytochrome b (cytb) gene, partial DE cds; mitochondrial. XX KW . XX OS Hemidactylus sataraensis OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Lepidosauria; Squamata; Bifurcata; Gekkota; Gekkonidae; Gekkoninae; OC Hemidactylus. OG Mitochondrion XX RN [1] RC Publication Status: Available-Online prior to print RP 1-277 RX DOI; 10.1016/j.ympev.2010.06.008. RX PUBMED; 20601015. RA Bansal R., Karanth K.P.; RT "Molecular phylogeny of Hemidactylus geckos (Squamata: Gekkonidae) of the RT Indian subcontinent reveals a unique Indian radiation and an Indian origin RT of Asian house geckos"; RL Mol. Phylogenet. Evol. 57(1):459-465(2010). XX RN [2] RP 1-277 RA Bansal R., Karanth K.P.; RT ; RL Submitted (29-JUN-2010) to the INSDC. RL Centre for Ecological Science, Indian Institute of Science, C. V. Raman RL Avenue, Bangalore, Karnataka 560012, India XX DR MD5; 6f94b894fd433f2339fb0de3487153fc. XX FH Key Location/Qualifiers FH FT source 1..277 FT /organism="Hemidactylus sataraensis" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /specimen_voucher="CES08010" FT /db_xref="taxon:863673" FT gene <1..>277 FT /gene="cytb" FT CDS <1..>277 FT /codon_start=1 FT /transl_table=2 FT /gene="cytb" FT /product="cytochrome b" FT /db_xref="GOA:E2ITV8" FT /db_xref="InterPro:IPR005797" FT /db_xref="InterPro:IPR016174" FT /db_xref="InterPro:IPR027387" FT /db_xref="UniProtKB/TrEMBL:E2ITV8" FT /protein_id="ADO17838.1" FT /translation="FGSLLGLCLVTQIITGLFLAMHYTAETTLAFSSVAHICRDVQYGW FT LIRNIHANGASMFFICLFLHIGRGLYYGSYLFKETWNTGVVLLLTTM" XX SQ Sequence 277 BP; 70 A; 80 C; 50 G; 77 T; 0 other; ttcggatcat tacttggact ctgcctggta actcaaatca tcaccgggct atttttagca 60 atacactaca cggctgaaac aacactggcc ttttcttctg tggcccacat ctgccgagac 120 gtacaatatg gctgactaat ccgaaacatc cacgctaacg gcgcctctat attcttcatt 180 tgcctattcc tccatattgg acgaggcctc tactacggct cctacttatt caaagagacc 240 tgaaacacag gagttgtcct tctactcacg acgatgg 277 //