ID HM595669; SV 1; linear; genomic DNA; STD; VRT; 251 BP. XX AC HM595669; XX DT 11-OCT-2010 (Rel. 106, Created) DT 11-OCT-2010 (Rel. 106, Last updated, Version 1) XX DE Hemidactylus reticulatus voucher CES07016 cytochrome b (cytb) gene, partial DE cds; mitochondrial. XX KW . XX OS Hemidactylus reticulatus OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Lepidosauria; Squamata; Bifurcata; Gekkota; Gekkonidae; Gekkoninae; OC Hemidactylus. OG Mitochondrion XX RN [1] RC Publication Status: Available-Online prior to print RP 1-251 RX DOI; 10.1016/j.ympev.2010.06.008. RX PUBMED; 20601015. RA Bansal R., Karanth K.P.; RT "Molecular phylogeny of Hemidactylus geckos (Squamata: Gekkonidae) of the RT Indian subcontinent reveals a unique Indian radiation and an Indian origin RT of Asian house geckos"; RL Mol. Phylogenet. Evol. 57(1):459-465(2010). XX RN [2] RP 1-251 RA Bansal R., Karanth K.P.; RT ; RL Submitted (29-JUN-2010) to the INSDC. RL Centre for Ecological Science, Indian Institute of Science, C. V. Raman RL Avenue, Bangalore, Karnataka 560012, India XX DR MD5; 82ebd48bb028143d93dde36b4678d0d4. XX FH Key Location/Qualifiers FH FT source 1..251 FT /organism="Hemidactylus reticulatus" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /specimen_voucher="CES07016" FT /db_xref="taxon:498597" FT gene <1..>251 FT /gene="cytb" FT CDS <1..>251 FT /codon_start=1 FT /transl_table=2 FT /gene="cytb" FT /product="cytochrome b" FT /db_xref="GOA:E2ITV5" FT /db_xref="InterPro:IPR005797" FT /db_xref="InterPro:IPR016174" FT /db_xref="InterPro:IPR027387" FT /db_xref="UniProtKB/TrEMBL:E2ITV5" FT /protein_id="ADO17835.1" FT /translation="FGSLLGLCLITQIATGLFLAMHYTADTSLAFSSVAHICRDVQHGW FT LIRNIHANGASMFFMCLFLHIGRGLYYGSYLFKETWNTG" XX SQ Sequence 251 BP; 69 A; 70 C; 40 G; 72 T; 0 other; ttcggttcat tactaggact ttgcctaatt actcaaatcg ccaccggact atttttagca 60 atacactata cagctgatac atcactcgcc ttctcctctg tagcccacat ttgccgcgac 120 gtacaacatg gctgactaat tcgaaacatc cacgctaacg gcgcctctat attctttata 180 tgcttattcc tgcacattgg acgaggacta tactacggct catacttatt caaagagacc 240 tgaaacacag g 251 //