ID HM595668; SV 1; linear; genomic DNA; STD; VRT; 293 BP. XX AC HM595668; XX DT 11-OCT-2010 (Rel. 106, Created) DT 11-OCT-2010 (Rel. 106, Last updated, Version 1) XX DE Hemidactylus prashadi voucher CES07040 cytochrome b (cytb) gene, partial DE cds; mitochondrial. XX KW . XX OS Hemidactylus prashadi OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Lepidosauria; Squamata; Bifurcata; Gekkota; Gekkonidae; Gekkoninae; OC Hemidactylus. OG Mitochondrion XX RN [1] RC Publication Status: Available-Online prior to print RP 1-293 RX DOI; 10.1016/j.ympev.2010.06.008. RX PUBMED; 20601015. RA Bansal R., Karanth K.P.; RT "Molecular phylogeny of Hemidactylus geckos (Squamata: Gekkonidae) of the RT Indian subcontinent reveals a unique Indian radiation and an Indian origin RT of Asian house geckos"; RL Mol. Phylogenet. Evol. 57(1):459-465(2010). XX RN [2] RP 1-293 RA Bansal R., Karanth K.P.; RT ; RL Submitted (29-JUN-2010) to the INSDC. RL Centre for Ecological Science, Indian Institute of Science, C. V. Raman RL Avenue, Bangalore, Karnataka 560012, India XX DR MD5; 220a20c8d09a3160d4c2d193a34e38d5. XX FH Key Location/Qualifiers FH FT source 1..293 FT /organism="Hemidactylus prashadi" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /specimen_voucher="CES07040" FT /db_xref="taxon:863657" FT gene <1..>293 FT /gene="cytb" FT CDS <1..>293 FT /codon_start=1 FT /transl_table=2 FT /gene="cytb" FT /product="cytochrome b" FT /db_xref="GOA:E2ITV2" FT /db_xref="InterPro:IPR005797" FT /db_xref="InterPro:IPR016174" FT /db_xref="InterPro:IPR027387" FT /db_xref="UniProtKB/TrEMBL:E2ITV2" FT /protein_id="ADO17834.1" FT /translation="FGSLLGLCLVAQIGTGLFLAMHFTADTTLSFASVAHICRDVQYGW FT LIRNIHANGASMFFICLYLHVGRGLYYGSYLYKETWNTGIILLLLTMATAFVG" XX SQ Sequence 293 BP; 76 A; 92 C; 52 G; 73 T; 0 other; tttggctcac tcctaggcct gtgtttagta gcacagattg ggactggcct attcctcgca 60 atacatttca ccgccgacac aacactgtcc ttcgcctctg tagcccacat ttgccgagac 120 gtccaatacg gctgactaat ccgaaacatc cacgccaacg gagcatcaat attcttcatc 180 tgcctctacc tccacgtagg ccgcggacta tactacggat catacttata caaagaaacc 240 tgaaatactg gcattatcct actactacta accatggcca ccgcattcgt agg 293 //