ID HM595664; SV 1; linear; genomic DNA; STD; VRT; 239 BP. XX AC HM595664; XX DT 11-OCT-2010 (Rel. 106, Created) DT 11-OCT-2010 (Rel. 106, Last updated, Version 1) XX DE Hemidactylus maculatus voucher CES08028 cytochrome b (cytb) gene, partial DE cds; mitochondrial. XX KW . XX OS Hemidactylus maculatus OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Lepidosauria; Squamata; Bifurcata; Gekkota; Gekkonidae; Gekkoninae; OC Hemidactylus. OG Mitochondrion XX RN [1] RC Publication Status: Available-Online prior to print RP 1-239 RX DOI; 10.1016/j.ympev.2010.06.008. RX PUBMED; 20601015. RA Bansal R., Karanth K.P.; RT "Molecular phylogeny of Hemidactylus geckos (Squamata: Gekkonidae) of the RT Indian subcontinent reveals a unique Indian radiation and an Indian origin RT of Asian house geckos"; RL Mol. Phylogenet. Evol. 57(1):459-465(2010). XX RN [2] RP 1-239 RA Bansal R., Karanth K.P.; RT ; RL Submitted (29-JUN-2010) to the INSDC. RL Centre for Ecological Science, Indian Institute of Science, C. V. Raman RL Avenue, Bangalore, Karnataka 560012, India XX DR MD5; 9f10eb07ee9c0a99a58fd4ed60b77e0e. XX FH Key Location/Qualifiers FH FT source 1..239 FT /organism="Hemidactylus maculatus" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /specimen_voucher="CES08028" FT /db_xref="taxon:863656" FT gene <1..>239 FT /gene="cytb" FT CDS <1..>239 FT /codon_start=3 FT /transl_table=2 FT /gene="cytb" FT /product="cytochrome b" FT /db_xref="GOA:E2ITU9" FT /db_xref="InterPro:IPR005797" FT /db_xref="InterPro:IPR016174" FT /db_xref="InterPro:IPR027387" FT /db_xref="UniProtKB/TrEMBL:E2ITU9" FT /protein_id="ADO17830.1" FT /translation="FTANTTLSFASIAHICRDVQYGWLIRNIHANGASMFFICLYLHIG FT RGLYYGSYLYKETWNTGIILLLLTMATAFVGYVL" XX SQ Sequence 239 BP; 70 A; 65 C; 35 G; 69 T; 0 other; acttcaccgc taacacaaca ctttcatttg cttcaatcgc ccacatttgc cgagacgtac 60 aatacggctg attaattcgt aacatccatg ccaatggagc ctcaatattc ttcatttgcc 120 tataccttca tatcgggcga ggattatact acggatctta cctatacaaa gaaacctgaa 180 atactggcat tatcctatta ctactaacca tagcaaccgc attcgtgggc tatgtccta 239 //