ID HM595660; SV 1; linear; genomic DNA; STD; VRT; 269 BP. XX AC HM595660; XX DT 11-OCT-2010 (Rel. 106, Created) DT 11-OCT-2010 (Rel. 106, Last updated, Version 1) XX DE Hemidactylus gracilis voucher CES07039 cytochrome b (cytb) gene, partial DE cds; mitochondrial. XX KW . XX OS Hemidactylus gracilis OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Lepidosauria; Squamata; Bifurcata; Gekkota; Gekkonidae; Gekkoninae; OC Hemidactylus. OG Mitochondrion XX RN [1] RC Publication Status: Available-Online prior to print RP 1-269 RX DOI; 10.1016/j.ympev.2010.06.008. RX PUBMED; 20601015. RA Bansal R., Karanth K.P.; RT "Molecular phylogeny of Hemidactylus geckos (Squamata: Gekkonidae) of the RT Indian subcontinent reveals a unique Indian radiation and an Indian origin RT of Asian house geckos"; RL Mol. Phylogenet. Evol. 57(1):459-465(2010). XX RN [2] RP 1-269 RA Bansal R., Karanth K.P.; RT ; RL Submitted (29-JUN-2010) to the INSDC. RL Centre for Ecological Science, Indian Institute of Science, C. V. Raman RL Avenue, Bangalore, Karnataka 560012, India XX DR MD5; 5e7bd95756a983efff1e3b1334ca39ff. XX FH Key Location/Qualifiers FH FT source 1..269 FT /organism="Hemidactylus gracilis" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /specimen_voucher="CES07039" FT /db_xref="taxon:498595" FT gene <1..>269 FT /gene="cytb" FT CDS <1..>269 FT /codon_start=1 FT /transl_table=2 FT /gene="cytb" FT /product="cytochrome b" FT /db_xref="GOA:E2ITU8" FT /db_xref="InterPro:IPR005797" FT /db_xref="InterPro:IPR016174" FT /db_xref="InterPro:IPR027387" FT /db_xref="UniProtKB/TrEMBL:E2ITU8" FT /protein_id="ADO17828.1" FT /translation="FGSLLGLCLMTQIASGLFLSMHYTAETTLAFSSVAHICRDVQYGW FT LIRNIHANGASMFFICLFLHIGRGLYYGSYLFKETWNTGVILLLT" XX SQ Sequence 269 BP; 71 A; 81 C; 43 G; 74 T; 0 other; ttcggctcat tactaggact atgcttaata acacaaattg cctcaggcct tttcttatca 60 atacactaca ccgccgaaac aaccctcgcc ttctcctccg tagcccacat ttgccgagat 120 gtacaatatg gctgattaat ccgcaacatc cacgctaacg gtgcctcgat gttctttatc 180 tgcttatttc ttcacatcgg acggggcctg tactacggat cctacctatt caaagaaacc 240 tgaaacaccg gagtaatcct gctactaac 269 //