ID HM595657; SV 1; linear; genomic DNA; STD; VRT; 266 BP. XX AC HM595657; XX DT 11-OCT-2010 (Rel. 106, Created) DT 11-OCT-2010 (Rel. 106, Last updated, Version 1) XX DE Hemidactylus giganteus voucher CES08013 cytochrome b (cytb) gene, partial DE cds; mitochondrial. XX KW . XX OS Hemidactylus giganteus OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Lepidosauria; Squamata; Bifurcata; Gekkota; Gekkonidae; Gekkoninae; OC Hemidactylus. OG Mitochondrion XX RN [1] RC Publication Status: Available-Online prior to print RP 1-266 RX DOI; 10.1016/j.ympev.2010.06.008. RX PUBMED; 20601015. RA Bansal R., Karanth K.P.; RT "Molecular phylogeny of Hemidactylus geckos (Squamata: Gekkonidae) of the RT Indian subcontinent reveals a unique Indian radiation and an Indian origin RT of Asian house geckos"; RL Mol. Phylogenet. Evol. 57(1):459-465(2010). XX RN [2] RP 1-266 RA Bansal R., Karanth K.P.; RT ; RL Submitted (29-JUN-2010) to the INSDC. RL Centre for Ecological Science, Indian Institute of Science, C. V. Raman RL Avenue, Bangalore, Karnataka 560012, India XX DR MD5; ff7b99f4432dc1ce275d233e218a339d. XX FH Key Location/Qualifiers FH FT source 1..266 FT /organism="Hemidactylus giganteus" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /specimen_voucher="CES08013" FT /db_xref="taxon:863652" FT gene <1..>266 FT /gene="cytb" FT CDS <1..>266 FT /codon_start=1 FT /transl_table=2 FT /gene="cytb" FT /product="cytochrome b" FT /db_xref="GOA:E2ITU5" FT /db_xref="InterPro:IPR005797" FT /db_xref="InterPro:IPR016174" FT /db_xref="InterPro:IPR027387" FT /db_xref="UniProtKB/TrEMBL:E2ITU5" FT /protein_id="ADO17825.1" FT /translation="FGSLLGLCLITQIATGLFLAMHYTAETTLAFTSVAHISRDVQYGW FT LIRNTHANGASMFFICLYLHIGRGVYYGSFLYKETWNTGIALL" XX SQ Sequence 266 BP; 74 A; 76 C; 49 G; 67 T; 0 other; ttcggctcac tactgggcct gtgcctaatt acacaaattg ccactgggct gtttttagca 60 atacactata ccgccgaaac aacactggca ttcacctcag tagcccacat ctcacgagac 120 gtacaatacg gatgactaat tcgaaacacc catgccaacg gagcatcaat attctttatc 180 tgcttgtacc tccacattgg ccgcggggtg tattacggat cctttctgta caaggaaaca 240 tgaaacaccg gcatcgcact actatt 266 //