ID HM595655; SV 1; linear; genomic DNA; STD; VRT; 239 BP. XX AC HM595655; XX DT 11-OCT-2010 (Rel. 106, Created) DT 11-OCT-2010 (Rel. 106, Last updated, Version 1) XX DE Hemidactylus frenatus voucher CES07035 cytochrome b (cytb) gene, partial DE cds; mitochondrial. XX KW . XX OS Hemidactylus frenatus (common house gecko) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Lepidosauria; Squamata; Bifurcata; Gekkota; Gekkonidae; Gekkoninae; OC Hemidactylus. OG Mitochondrion XX RN [1] RC Publication Status: Available-Online prior to print RP 1-239 RX DOI; 10.1016/j.ympev.2010.06.008. RX PUBMED; 20601015. RA Bansal R., Karanth K.P.; RT "Molecular phylogeny of Hemidactylus geckos (Squamata: Gekkonidae) of the RT Indian subcontinent reveals a unique Indian radiation and an Indian origin RT of Asian house geckos"; RL Mol. Phylogenet. Evol. 57(1):459-465(2010). XX RN [2] RP 1-239 RA Bansal R., Karanth K.P.; RT ; RL Submitted (29-JUN-2010) to the INSDC. RL Centre for Ecological Science, Indian Institute of Science, C. V. Raman RL Avenue, Bangalore, Karnataka 560012, India XX DR MD5; 597964762e1811c793ac69e222653f72. XX FH Key Location/Qualifiers FH FT source 1..239 FT /organism="Hemidactylus frenatus" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /specimen_voucher="CES07035" FT /db_xref="taxon:47729" FT gene <1..>239 FT /gene="cytb" FT CDS <1..>239 FT /codon_start=3 FT /transl_table=2 FT /gene="cytb" FT /product="cytochrome b" FT /db_xref="GOA:E2ITU3" FT /db_xref="InterPro:IPR005797" FT /db_xref="InterPro:IPR016174" FT /db_xref="InterPro:IPR027387" FT /db_xref="UniProtKB/TrEMBL:E2ITU3" FT /protein_id="ADO17823.1" FT /translation="YTADTTMAFASIAHICRDVQYGWLIRNIHANGASMFFICLYLHVG FT RGLYYGSYLYKETWNTGIILLFMTMAAAFMGYVL" XX SQ Sequence 239 BP; 64 A; 72 C; 43 G; 60 T; 0 other; actacactgc cgacacaaca atagcctttg cttcaatcgc ccacatctgc cgagatgtgc 60 aatatggctg actaatccgc aacatccacg ccaacggcgc ctcaatattc ttcatctgcc 120 tatacctgca cgttggacgg ggtctgtact acggctctta cctatacaaa gaaacttgaa 180 acacgggcat cattctactg tttataacca tagccgctgc attcatgggc tacgtacta 239 //