ID HG800022; SV 1; linear; genomic DNA; STD; INV; 390 BP. XX AC HG800022; XX DT 08-OCT-2014 (Rel. 122, Created) DT 08-OCT-2014 (Rel. 122, Last updated, Version 1) XX DE Ogcodes sp. CK608 mitochondrial partial COI gene for cytochrome oxidase DE subunit 1, specimen voucher CK608 XX KW . XX OS Ogcodes sp. CK608 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Diptera; Brachycera; Muscomorpha; Nemestrinoidea; OC Acroceridae; Ogcodes; unclassified Ogcodes. OG Mitochondrion XX RN [1] RP 1-390 RA Kehlmaier C.; RT ; RL Submitted (29-NOV-2013) to the INSDC. RL Senckenberg Natural History Collections, Dresden, Museum of Zoology, RL Koenigsbruecker Landstrasse 159, Dresden, 01109, GERMANY. XX RN [2] RX DOI; 10.11646/zootaxa.3869.2.7. RX PUBMED; 25283910. RA Kehlmaier C., Gharali B., Majnon Jahromi B.; RT "A new Corononcodes Speiser from the Palaearctic Region, with a key to RT species (Diptera: Acroceridae)"; RL Zootaxa 3869(2):171-179(2014). XX DR MD5; 8265f6ce3aff8f1075c4beee9d294901. XX FH Key Location/Qualifiers FH FT source 1..390 FT /organism="Ogcodes sp. CK608" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /country="Iran:Ghazvin city" FT /specimen_voucher="CK608" FT /db_xref="taxon:1450335" FT CDS <1..>123 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A097ZS11" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A097ZS11" FT /protein_id="CDL74819.1" FT /translation="PPSLXLMLTSNMADLGIGTGWTIYPPLSSNLFHNSPSVDLA" XX SQ Sequence 390 BP; 117 A; 76 C; 44 G; 152 T; 1 other; cccccttctt taanattaat attaactagc aatatagcag atttaggaat tggaacaggc 60 tgaactattt atcctccact ttcatctaac ttatttcata atagcccttc agttgactta 120 gctattttct ctcttcattt agctggaatt tcctcaattt taggagctat taattttatt 180 acaacaatca ttaatataca tgtaccaaat atgacctttg atcgaatacc cctatttgtt 240 tgatcagtat ttattacagc tattttatta ctattatcac tcccagtatt agcaggagct 300 atcacaatac ttctttcaga tcgaaatttt aatacaacct tttttgatcc tgcaggagga 360 ggagatccta ttttatatca acatttattt 390 //