ID HE802637; SV 1; linear; genomic DNA; STD; INV; 230 BP. XX AC HE802637; XX DT 22-JUN-2012 (Rel. 113, Created) DT 22-JUN-2012 (Rel. 113, Last updated, Version 1) XX DE Thyestetha sp. ARC1355 partial EF1a gene for elongation factor 1-alpha, DE isolate ARC1355 XX KW . XX OS Thyestetha glabra OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; OC Cryptorhynchinae; Thyestetha. XX RN [1] RP 1-230 RA Balke M.; RT ; RL Submitted (23-MAR-2012) to the INSDC. RL Entomology, Zoological State Collection, Muenchhausenstrasse 21, 81247 RL Munich, GERMANY. XX RN [2] RA Eberle J., Taenzler R., Riedel A.; RT "Revision and phylogenetic analysis of the Papuan weevil genus Thyestetha RT Pascoe (Coleoptera, Curculionidae, Cryptorhynchinae)"; RL Unpublished. XX DR MD5; 0175fcd17f35f06880e3e3c88a2d6cfb. XX FH Key Location/Qualifiers FH FT source 1..230 FT /organism="Thyestetha glabra" FT /isolate="ARC1355" FT /mol_type="genomic DNA" FT /db_xref="taxon:1178801" FT CDS <1..>230 FT /codon_start=2 FT /transl_table=1 FT /gene="EF1a" FT /product="elongation factor 1-alpha" FT /db_xref="GOA:I7IW57" FT /db_xref="InterPro:IPR000795" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:I7IW57" FT /protein_id="CCH26334.1" FT /translation="HALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFDEIKKEVSSYIKK FT IGYNPAAVAFVPISGWHGDNMLEASXKMPWF" XX SQ Sequence 230 BP; 69 A; 54 C; 41 G; 56 T; 10 other; acatgccctg ctygctttca cccttggagt aaaacaactt atcgtcggtg taaacaaaat 60 ggactccact gaaccaccat acagcgaacc ccgtttygac gaaatcaara aagaagtttc 120 ytcatacatc aagaaaattg gttacaatcc agcygctgtt gcyttygtac caatctctgg 180 ttggcatgga gataacatgt trgargcttc cascaaaatg ccatggttca 230 //