ID GQ851283; SV 1; linear; genomic DNA; STD; INV; 420 BP. XX AC GQ851283; XX DT 13-FEB-2011 (Rel. 107, Created) DT 10-MAR-2011 (Rel. 108, Last updated, Version 2) XX DE Meridolum gilberti isolate Gambubal cytochrome oxidase subunit II gene, DE partial cds; mitochondrial. XX KW . XX OS Meridolum gilberti OC Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca; Gastropoda; OC Heterobranchia; Euthyneura; Panpulmonata; Eupulmonata; Stylommatophora; OC Helicina; Camaenoidea; Camaenidae; Meridolum. OG Mitochondrion XX RN [1] RP 1-420 RA Hugall A.F., Stanisic J.; RT "Beyond the prolegomenon: a molecular phylogeny of the Australian Camaenid RT land snail radiation"; RL Zool. J. Linn. Soc. 161(3):531-572(2011). XX RN [2] RP 1-420 RA Hugall A.F., Stanisic J.; RT ; RL Submitted (27-AUG-2009) to the INSDC. RL School of Earth and Environmental Sciences, University of Adelaide, ACEEB, RL Darling Building, North Terrace, Adelaide, South Australia 5005, Australia XX DR MD5; 92c8360d449df24ae526428d3b26d595. XX FH Key Location/Qualifiers FH FT source 1..420 FT /organism="Meridolum gilberti" FT /organelle="mitochondrion" FT /isolate="Gambubal" FT /mol_type="genomic DNA" FT /db_xref="taxon:885648" FT CDS <1..>420 FT /codon_start=1 FT /transl_table=5 FT /product="cytochrome oxidase subunit II" FT /db_xref="GOA:E9JEX4" FT /db_xref="InterPro:IPR002429" FT /db_xref="InterPro:IPR008972" FT /db_xref="InterPro:IPR011759" FT /db_xref="InterPro:IPR036257" FT /db_xref="UniProtKB/TrEMBL:E9JEX4" FT /protein_id="ADX07140.1" FT /translation="FLSSKYSTRSVHEAQTLEILWTILPVVLLVSLALPSLRLLYLLDE FT QPVNGKNTLKVIGHQWYWSYESPFLNNKLFDSYMTPEASLLPGEYRLLEVDNRVPVPVG FT VDTSVITTSADVIHAWALPSMGVKMDLGPGRLNMMS" XX SQ Sequence 420 BP; 103 A; 83 C; 98 G; 135 T; 1 other; tttttgaggt cgaaatactc gacccgcagg gtccatgaag ctcagactct cgagattctt 60 tgaactattt tacctgttgt gttgctcgtt agattggcct tacctaggtt acgcttgctt 120 tatttattgg atgagcagcc ngtcaacggg aagaatactc ttaaagtgat tggtcatcag 180 tgatattgga gttatgagtc tcctttttta aataacaaac tatttgatag ttatatgacg 240 cctgaggcta gtttattgcc gggtgaatac cgtctcttgg aagtggataa ccgcgttcct 300 gtgcctgtgg gtgtagatac atctgttatc accacatcag ctgatgtaat ccatgcttga 360 gccctcccat cgataggagt aaagatagat ttgggccctg gccgcctaaa tataatgaga 420 //