ID GQ415493; SV 1; linear; genomic DNA; STD; INV; 338 BP. XX AC GQ415493; XX DT 22-JUL-2010 (Rel. 105, Created) DT 22-JUL-2010 (Rel. 105, Last updated, Version 1) XX DE Ophryotrocha craigsmithi voucher SMNH106087 histone H3 gene, partial cds. XX KW . XX OS Ophryotrocha craigsmithi OC Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Annelida; Polychaeta; OC Palpata; Aciculata; Eunicida; Dorvilleidae; Ophryotrocha. XX RN [1] RP 1-338 RA Wiklund H., Glover A.G., Dahlgren T.G.; RT "Three new species of Ophryotrocha (Annelida; Dorvilleidae) from a RT whale-fall in the North East Atlantic"; RL Zootaxa 2228:43-56(2009). XX RN [2] RP 1-338 RA Wiklund H., Glover A.G., Dahlgren T.G.; RT ; RL Submitted (25-JUL-2009) to the INSDC. RL Department of Zoology, University of Gothenburg, PO Box 463, Goteborg RL SE-405 30, Sweden XX DR MD5; 94d7089e70d78c23107e3a0d15b80cc0. XX FH Key Location/Qualifiers FH FT source 1..338 FT /organism="Ophryotrocha craigsmithi" FT /mol_type="genomic DNA" FT /specimen_voucher="SMNH106087" FT /db_xref="taxon:864289" FT mRNA <1..>338 FT /product="histone H3" FT CDS <1..>338 FT /codon_start=1 FT /product="histone H3" FT /db_xref="GOA:E2D009" FT /db_xref="InterPro:IPR000164" FT /db_xref="InterPro:IPR007125" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/TrEMBL:E2D009" FT /protein_id="ADK34661.1" FT /translation="ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREI FT RRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC FT AIHAKRVT" XX SQ Sequence 338 BP; 81 A; 108 C; 81 G; 68 T; 0 other; gctcgcaaat ctaccggagg caaagcccca cgcaaacagt tggccaccaa ggctgctcgc 60 aagagtgcac cagccaccgg gggtgtgaag aaacctcaca gatacagacc cggaactgtc 120 gctcttcgtg agatccgtcg ttaccaaaag agcactgagc ttctcatccg taagcttccc 180 ttccagcgtc tggttcgtga gattgcacaa gacttcaaga ccgacctccg cttccagtca 240 tctgccgtta tggctctgca agaggccagc gaagcttatc tcgtcggact cttcgaggac 300 accaacttgt gcgccatcca tgccaagcgt gtcaccat 338 //