ID FJ171276; SV 1; linear; genomic DNA; STD; INV; 379 BP. XX AC FJ171276; XX DT 15-JAN-2009 (Rel. 99, Created) DT 10-AUG-2009 (Rel. 101, Last updated, Version 3) XX DE Myrsidea simplex voucher FMNH:Mysi.6.14.2006.3 cytochrome oxidase subunit I DE (COI) gene, partial cds; mitochondrial. XX KW . XX OS Myrsidea simplex OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Paraneoptera; Psocodea; Phthiraptera; Amblycera; Menoponidae; OC Myrsidea. OG Mitochondrion XX RN [1] RP 1-379 RX DOI; 10.1645/GE-1642.1. RX PUBMED; 18821823. RA Bueter C., Weckstein J., Johnson K.P., Bates J.M., Gordon C.E.; RT "Comparative phylogenetic histories of two louse genera found on Catharus RT thrushes and other birds"; RL J. Parasitol. 95(2):295-307(2009). XX RN [2] RP 1-379 RA Bueter C., Weckstein J.D., Johnson K.P., Bates J.M., Gordon C.E.; RT ; RL Submitted (27-AUG-2008) to the INSDC. RL Zoology, Field Museum of Natural History, 1400 South Lake Shore Drive, RL Chicago, IL 60605-2496, USA XX DR MD5; 9666731b1ee4ac1809a22d708899eba4. XX FH Key Location/Qualifiers FH FT source 1..379 FT /organism="Myrsidea simplex" FT /organelle="mitochondrion" FT /host="Catharus fuscater (MBM JK06-062)" FT /mol_type="genomic DNA" FT /country="Panama:Serriana del Maje" FT /specimen_voucher="FMNH:Mysi.6.14.2006.3" FT /collection_date="16-Feb-2006" FT /db_xref="taxon:586354" FT gene <1..>379 FT /gene="COI" FT CDS <1..>379 FT /codon_start=2 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit I" FT /db_xref="GOA:B8X6T8" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:B8X6T8" FT /protein_id="ACL50901.1" FT /translation="EVYILILPAFGIISHIITQESGKKESFGVTGMIYAMLSIGVLGFI FT VWAHHMFTVGMDIDTRAYFTSATMVIAIPTGVKVFSWLSTLLGNKLNYNPNLLWVVGFV FT FLFTIGGLTGVVLANSSIDIIL" XX SQ Sequence 379 BP; 100 A; 68 C; 78 G; 133 T; 0 other; agaagtttac attttaatct tgccggcgtt cggaatcatc tcacacatta ttactcaaga 60 gagtggtaaa aaggagagct ttggggttac tgggatgatt tatgcaatat tatcaattgg 120 agtgttagga ttcattgttt gagcacatca catgttcact gtaggtatag atattgatac 180 tcgggcttac tttacatccg ccactatagt aattgctatt cccacggggg ttaaggtatt 240 caggtgactc tctactcttt tagggaataa acttaactac aaccctaacc tactgtgagt 300 ggtaggcttt gtatttctct tcactattgg aggtttaaca ggagttgtcc ttgctaattc 360 ctctattgac atcatttta 379 //