ID EU289214; SV 1; linear; genomic DNA; STD; INV; 379 BP. XX AC EU289214; XX DT 16-DEC-2008 (Rel. 98, Created) DT 31-AUG-2025 (Rel. 144, Last updated, Version 7) XX DE Myrsidea bessae voucher Mysp.Thfas.5.1.2006.7 cytochrome oxdiase subunit I DE (COI) gene, partial cds; mitochondrial. XX KW . XX OS Myrsidea bessae OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Paraneoptera; Psocodea; Troctomorpha; Phthiraptera; Amblycera; OC Menoponidae; Myrsidea. OG Mitochondrion XX RN [1] RP 1-379 RA Price R.D., Johnson K.P., Dalgleish R.C.; RT "Myrsidea Waterston (Phthiraptera: Menoponidae) from wrens (Passeriformes: RT Troglodytidae), with descriptions of three new species"; RL Zootaxa 1740:59-65(2008). XX RN [2] RP 1-379 RA Johnson K.P.; RT ; RL Submitted (20-NOV-2007) to the INSDC. RL Section for Biodiversity, Illinois Natural History Survey, 1816 S. Oak RL Street, Champaign, IL 61820, USA XX DR MD5; 08f447d31123c237fe1c47ef3572fe4b. XX FH Key Location/Qualifiers FH FT source 1..379 FT /organism="Myrsidea bessae" FT /organelle="mitochondrion" FT /host="Thryothorus fasciatoventris" FT /mol_type="genomic DNA" FT /specimen_voucher="Mysp.Thfas.5.1.2006.7" FT /db_xref="taxon:506792" FT gene <1..>379 FT /gene="COI" FT CDS <1..>379 FT /codon_start=2 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxdiase subunit I" FT /protein_id="ACA50445.1" FT /translation="EVYILILPAFGIISHMISQESGKKESFGVIGMIYAMLSIGVLGFI FT VWAHHMFTVGMDIDTRAYFTSATMVIAIPTGVKVFSWLSTLLGNKLTYSPNTMWSVGFV FT FLFTIGGLTGVILANSSIDIIL" XX SQ Sequence 379 BP; 107 A; 61 C; 77 G; 134 T; 0 other; tgaagtttat attctaatct tgccggcatt tggtattatt tcacatatga tttcacagga 60 aagagggaaa aaggagagat ttggagttat tggaatgatt tatgcaatat tatctattgg 120 ggtactaggt ttcattgtgt gagcacatca catatttaca gttggtatag atattgatac 180 gcgagcatac tttacttcag ctacaatggt aattgccatc ccgacagggg tcaaagtgtt 240 taggtgactt tccaccttac ttggaaacaa gttgacttac agacctaata caatatgatc 300 tgtaggcttt gtattcctct ttactattgg aggtttaaca ggagttattc tcgctaattc 360 gtctattgac atcattctc 379 //