ID EF519653; SV 1; linear; genomic DNA; STD; INV; 584 BP. XX AC EF519653; XX DT 21-FEB-2008 (Rel. 94, Created) DT 21-FEB-2008 (Rel. 94, Last updated, Version 1) XX DE Neofibularia nolitangere voucher B183 cytochrome oxidase subunit I (cox1) DE gene, partial cds; mitochondrial. XX KW . XX OS Neofibularia nolitangere OC Eukaryota; Metazoa; Porifera; Demospongiae; Heteroscleromorpha; Biemnida; OC Biemnidae; Neofibularia. OG Mitochondrion XX RN [1] RP 1-584 RA Erpenbeck D., Duran S., Ruetzler K., Paul V., Hooper J.N.A., Woerheide G.; RT "Towards a DNA taxonomy of Caribbean demosponges: a gene tree reconstructed RT from partial mitochondrial CO1 gene sequences supports previous rDNA RT phylogenies and provides a new perspective on the systematics of RT Demospongiae"; RL J. Mar. Biolog. Assoc. U. K. 87(6):1563-1570(2008). XX RN [2] RP 1-584 RA Erpenbeck D., Duran S., Ruetzler K., Paul V., Hooper J.N.A., Woerheide G.; RT ; RL Submitted (23-MAR-2007) to the INSDC. RL Biodiversity Program, Queensland Museum, P.O. Box 3300, South Brisbane, QLD RL 4101, Australia XX DR MD5; 6520a95a4565821c8bf2118954bd197e. XX FH Key Location/Qualifiers FH FT source 1..584 FT /organism="Neofibularia nolitangere" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /specimen_voucher="B183" FT /db_xref="taxon:458507" FT gene <1..>584 FT /gene="cox1" FT CDS <1..>584 FT /codon_start=1 FT /transl_table=4 FT /gene="cox1" FT /product="cytochrome oxidase subunit I" FT /db_xref="GOA:B0YL01" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:B0YL01" FT /protein_id="ABU24941.1" FT /translation="MIGTAFSMLIRLELSAPGSMLGDDHLYNVIVTAHAFVMIFFLVMP FT VMIGGFGNWFVPLYIGAPDMAFPRLNNISFWLLPPALTLLLSSAFVEQGAGTGWTVYPP FT LAGIQTHSGGSVDMAIFSLHLAGLSSILAAMNFITTIFNMRAPGITMDRMPLFVWSILV FT TAFLLLLSLPILAGSITMLLTDRNFNTAFFDP" XX SQ Sequence 584 BP; 157 A; 86 C; 114 G; 227 T; 0 other; atgataggga ctgcctttag tatgcttatt aggttagaac tttcagctcc tggttcaatg 60 ttaggggatg atcatttata taatgttatt gttactgctc atgcttttgt aatgatattt 120 tttttagtta tgcctgtaat gattggagga tttggaaatt gatttgtacc attatatatt 180 ggggccccgg atatggcctt tccgagatta aataatatta gtttttgatt attgccgcct 240 gcattaactt tattattaag ttcagctttt gtggaacagg gagcaggaac aggatgaacg 300 gtttatcctc cattagctgg gattcaaact cattcaggag gatcggtgga tatggcaata 360 tttagtcttc atttagccgg tttatcttca atattggctg ctatgaattt tattacaact 420 atctttaata tgagagcacc aggaattaca atggatagaa tgccgttatt tgtatgatct 480 attttagtta cagccttttt attattatta tctttaccaa tattagctgg aagtataaca 540 atgcttctta cggatcgaaa ttttaatact gcattctttg accc 584 //