ID EF519603; SV 1; linear; genomic DNA; STD; INV; 584 BP. XX AC EF519603; XX DT 21-FEB-2008 (Rel. 94, Created) DT 21-FEB-2008 (Rel. 94, Last updated, Version 1) XX DE Cinachyrella kuekenthali voucher K75 cytochrome oxidase subunit I (cox1) DE gene, partial cds; mitochondrial. XX KW . XX OS Cinachyrella kuekenthali OC Eukaryota; Metazoa; Porifera; Demospongiae; Heteroscleromorpha; OC Tetractinellida; Spirophorina; Tetillidae; Cinachyrella. OG Mitochondrion XX RN [1] RP 1-584 RA Erpenbeck D., Duran S., Ruetzler K., Paul V., Hooper J.N.A., Woerheide G.; RT "Towards a DNA taxonomy of Caribbean demosponges: a gene tree reconstructed RT from partial mitochondrial CO1 gene sequences supports previous rDNA RT phylogenies and provides a new perspective on the systematics of RT Demospongiae"; RL J. Mar. Biolog. Assoc. U. K. 87(6):1563-1570(2008). XX RN [2] RP 1-584 RA Erpenbeck D., Duran S., Ruetzler K., Paul V., Hooper J.N.A., Woerheide G.; RT ; RL Submitted (23-MAR-2007) to the INSDC. RL Biodiversity Program, Queensland Museum, P.O. Box 3300, South Brisbane, QLD RL 4101, Australia XX DR MD5; 5c1eb449695a82817f3ae3f35e456bf4. XX FH Key Location/Qualifiers FH FT source 1..584 FT /organism="Cinachyrella kuekenthali" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /specimen_voucher="K75" FT /db_xref="taxon:458489" FT gene <1..>584 FT /gene="cox1" FT CDS <1..>584 FT /codon_start=1 FT /transl_table=4 FT /gene="cox1" FT /product="cytochrome oxidase subunit I" FT /db_xref="GOA:B0YKV0" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:B0YKV0" FT /protein_id="ABU24891.1" FT /translation="MIGSGFSLLIRLELSAPGSMLGDDQLYNVMVTAHGLIMVFFLVMP FT VMIGGFGNWLVPLYIGAPDMAFPRLNNISFWVLPPSAILLLGSAFVEQGVGTGWTLYPP FT LSSIQAHSGGSVDAAIFSIHLAGISSILGSMNFITTIFNMRAPGITMDRLPLFVWSILV FT TTYLLLLALPVLAGAITMLLTDRNFNTTFFDP" XX SQ Sequence 584 BP; 139 A; 107 C; 129 G; 209 T; 0 other; atgataggga gtgggtttag tttgcttata agattagaac tatccgcccc cgggtcaatg 60 ttgggggatg accaattata caatgttatg gtcacggccc acggtcttat aatggtcttt 120 tttttagtga tgccggttat gatagggggg tttggtaatt gattggttcc cctttatatc 180 ggtgcgccag atatggcttt cccaagatta aacaatatta gtttttgagt tctaccgcct 240 tcagccatac tactgttagg ttctgctttt gttgaacaag gggttgggac aggatgaacc 300 ctttatccac cattatcaag tatacaagct cattccgggg gctcagttga tgcggcaatt 360 tttagtattc atttggccgg tatctcttca attttagggt cgatgaactt tataactact 420 atctttaata tgcgggctcc agggattacc atggatagac tgcctttatt tgtttgatca 480 atcttagtaa caacttactt gttattatta gcgttgcctg tattggcggg tgctattact 540 atgcttttaa cagatagaaa tttcaataca actttcttcg atcc 584 //